close all open/close all

CDS information : Oligo_00060


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction7,658 / 10,486 / + [in whole cluster]
7,658 / 10,486 / + [in contig]
Location7658..10486 [in whole cluster]
7658..10486 [in contig]
TypeCDS
Length2,829 bp (942 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)luxR-family transcriptional regulatory protein
Gene
Gene (GenBank)olmRII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Related Reference
ACC
Q9ZGI0
NITE
Pikro_00180
PmId
[11344155] Characterization and analysis of the PikD regulatory factor in the pikromycin biosynthetic pathway of Streptomyces venezuelae. (J Bacteriol. , 2001)
[18245260] Enhanced heterologous production of desosaminyl macrolides and their hydroxylated derivatives by overexpression of the pikD regulatory gene in Streptomyces venezuelae. (Appl Environ Microbiol. , 2008)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [luxR-family transcriptional regulatory protein]
MLASAGQGEGGVVLVNAGPGVGRTALLDAFLRKATESGARVCAAAGSSAETEAEFGVVGQ
LFPPTGPLGAGFRLARAIGSRDAGPGLDADRLFDALCQELRRRPTVIAVDDAQLADAASL
RFLRYLVRRLRTAPVMMVLTEPTGPDALPPSFQAELLRHPQCRRLGLLPLSRDGVTQVVS
AQVGSDRVPRLAADFHAISGGNPLLVHALLADHRAAHRLSPVPSVPTVPSVSSASSAASA
SSAASAASAVSAAPAASAAFAKAALAWAYRDEPVLFDVACGFAVLGESATPARVACLVDR
GADAVDQVMTALDTAGLLAGGTFRSALVGKALLEHVDVETRAELRRRAARLLHGDGAPAT
VVARHLLAAPVAEPWAGRTLLAAAEKAMQEGREELSLDCLRLAGQSATTEQERAAVVMAR
VKIGWEIDPRLVSPWLDELVAALRRGDLRSGDAAWIVKHLAWQDRFPEAVESLSTLAAAG
DAGEPGVEAELHFVRHWLRHSCPPLEASVPGPSNPTRPRTPRLRRVSPASYAGEVLGKVL
TEGPDDHTVAMAEEILRGCRYSETVVEALEAALLALVYAGRPDRAAFWCDGLLQQAGTRS
TGTSVAILSGIRAEIALRQGALPAVEQYARSALSAISLPGWGVAVGSPLAALVHSTTASG
MSGVAGAWLNQAVPDGMFRTRHGLLYTHARGHYHLAVDRPAAALDDFLTCGGLAKEWGMD
VPTFLPWRTSAAQAQLALGNPGQARALVREQLGRPGGSTARARGVALRLLAATGEPGRRP
ALLRESVNLLESCGDQVELLRALADRCQALDHVGAPAKARMTARHARNVADACGGDALFR
KLFRDEVPDREGDPDGLTGEEQGSASLTAAERRVTALAALGHSNREIGRKLFITKSTVEQ
HLTRVYRKLGVRNRADLGDLLAGTNLGAGTPAMAMASSAVAG
selected fasta
>putative LuxR family transcriptional regulator [luxR-family transcriptional regulatory protein]
GTGCTGGCGAGTGCCGGACAGGGCGAAGGCGGTGTGGTCCTCGTCAACGCGGGGCCGGGA
GTCGGCAGAACGGCACTGCTCGACGCGTTCCTGCGGAAGGCCACCGAATCCGGCGCCCGG
GTGTGCGCCGCCGCGGGCTCGTCCGCCGAGACCGAGGCCGAGTTCGGCGTCGTCGGCCAG
CTTTTCCCGCCGACCGGTCCGCTGGGCGCCGGATTCCGATTGGCCCGGGCGATCGGGAGC
CGCGACGCCGGTCCCGGGCTCGACGCGGACCGGCTCTTCGACGCGCTGTGCCAGGAGCTC
CGGCGCCGGCCGACGGTGATCGCCGTCGACGACGCGCAGCTCGCCGACGCGGCCTCGCTG
CGGTTCCTGCGGTACCTCGTACGACGGCTGCGGACGGCCCCGGTCATGATGGTGCTCACC
GAACCCACCGGGCCCGACGCGCTGCCGCCGTCCTTCCAGGCCGAACTCCTGCGCCATCCG
CAGTGCCGCCGCCTCGGACTGCTGCCCCTGTCCCGGGACGGTGTCACCCAGGTGGTCTCG
GCCCAGGTGGGCAGCGACCGGGTACCGCGCCTCGCGGCGGACTTCCACGCCATCAGCGGG
GGCAACCCGCTCCTCGTCCACGCGCTGCTGGCGGACCACCGGGCAGCGCACCGGCTCTCA
CCTGTCCCCTCTGTCCCTACTGTCCCCTCTGTTTCCTCTGCCTCGTCAGCTGCGTCTGCC
TCGTCCGCTGCGTCCGCTGCGTCCGCCGTGTCCGCCGCGCCCGCCGCCAGTGCCGCCTTC
GCCAAGGCGGCCCTCGCCTGGGCCTACCGCGACGAGCCCGTGCTCTTCGACGTCGCCTGC
GGCTTCGCCGTACTCGGCGAGTCGGCGACCCCCGCCCGGGTGGCCTGTCTGGTCGACCGG
GGGGCCGACGCCGTCGACCAGGTCATGACGGCGCTGGACACGGCGGGCCTGCTGGCGGGC
GGCACCTTCCGCAGCGCCCTCGTCGGCAAGGCCCTGCTGGAGCACGTGGACGTGGAGACC
AGGGCGGAACTGCGCCGCCGCGCCGCCCGGCTGCTCCATGGCGACGGAGCGCCGGCGACC
GTCGTCGCGCGGCATCTCCTCGCCGCCCCGGTCGCCGAGCCCTGGGCGGGCCGCACCCTG
CTCGCCGCCGCGGAGAAGGCCATGCAGGAAGGGCGGGAGGAACTCAGCCTCGACTGCCTG
CGACTGGCCGGACAGAGCGCGACGACCGAACAGGAACGCGCCGCCGTCGTCATGGCCCGG
GTGAAGATCGGCTGGGAGATCGACCCCCGGCTGGTGAGCCCGTGGCTCGACGAACTCGTC
GCCGCGCTCAGGCGGGGCGACCTCAGGAGCGGGGACGCCGCCTGGATCGTCAAGCACCTC
GCCTGGCAGGACCGTTTCCCTGAGGCCGTGGAGAGCCTCTCGACGCTGGCCGCGGCCGGC
GATGCCGGCGAACCCGGCGTGGAGGCCGAACTCCACTTCGTACGGCACTGGTTGCGCCAC
TCCTGTCCGCCGTTGGAGGCGAGCGTCCCGGGCCCCTCGAACCCCACGAGGCCGCGCACG
CCCCGCCTGCGCCGGGTGAGCCCGGCCTCCTACGCCGGCGAGGTGCTCGGCAAGGTCCTC
ACCGAGGGCCCCGACGACCACACCGTCGCCATGGCGGAGGAGATCCTGCGGGGCTGCCGG
TACAGCGAGACGGTCGTCGAGGCCCTGGAGGCGGCGCTCCTGGCCCTGGTCTACGCGGGG
CGTCCGGACCGCGCGGCGTTCTGGTGCGACGGGCTGCTCCAGCAGGCCGGAACCCGCTCG
ACGGGCACGTCGGTGGCGATCCTCTCCGGCATCCGGGCGGAGATCGCGCTCAGGCAGGGC
GCGCTGCCCGCCGTGGAACAGTACGCGCGCAGCGCCCTCTCGGCCATCTCGCTGCCCGGC
TGGGGGGTGGCCGTCGGCTCCCCGCTGGCCGCACTGGTGCACTCCACCACGGCGTCGGGG
ATGAGCGGGGTGGCCGGGGCCTGGCTCAACCAGGCCGTCCCCGACGGTATGTTCCGCACC
CGCCACGGACTCCTCTACACCCACGCCCGGGGCCACTACCACCTCGCCGTCGACCGCCCG
GCCGCCGCCCTCGACGACTTCCTGACCTGTGGCGGGCTCGCGAAGGAGTGGGGCATGGAC
GTGCCCACGTTCCTTCCGTGGCGGACCTCCGCGGCGCAGGCGCAGCTCGCCCTCGGCAAC
CCCGGTCAGGCGCGGGCGCTGGTGCGGGAGCAGCTCGGGCGGCCGGGCGGCAGTACGGCG
AGGGCCCGCGGAGTGGCCCTGCGCCTGCTCGCCGCCACGGGCGAACCCGGCCGGCGTCCC
GCGTTGCTGCGCGAGTCGGTCAACCTGCTGGAGAGCTGCGGCGACCAGGTGGAACTCCTC
CGTGCCCTGGCCGATCGCTGCCAGGCGTTGGACCACGTCGGTGCGCCCGCGAAGGCACGG
ATGACGGCCCGGCACGCCAGGAACGTCGCCGACGCCTGCGGCGGGGATGCGCTGTTCCGC
AAGCTCTTCCGGGACGAGGTGCCCGACCGCGAGGGCGACCCCGACGGGCTGACGGGCGAG
GAGCAGGGCTCCGCGAGCCTGACGGCGGCGGAGCGGCGGGTCACCGCCCTGGCCGCGCTC
GGCCACTCCAACCGCGAGATCGGGCGCAAGCTGTTCATCACCAAGAGCACCGTCGAGCAG
CACCTCACCCGCGTCTACCGGAAGCTCGGGGTGCGCAACCGGGCCGACCTGGGCGATCTG
CTCGCCGGGACGAACCTCGGCGCCGGGACACCGGCCATGGCCATGGCGTCCTCGGCCGTC
GCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [867-881]  3.79999862644791e-08 PR00038 [881-897]  3.79999862644791e-08 PR00038 [897-909]  3.79999862644791e-08 PR00038
PR00038   HTHLUXR
 [864-921]  1.29999924468179e-22 SM00421
SM00421   HTH_LUXR
 [865-917]  4.2e-13 PF00196
PF00196   GerE
 [860-925]  PS50043
PS50043   HTH_LUXR_2
 [881-908]  PS00622
PS00622   HTH_LUXR_1
IPR011990 Tetratricopeptide-like helical (Domain)
 [578-875]  9.50000000000001e-09 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [876-921]  4.00000000000001e-19 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [845-926]  5.20000089003336e-16 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit