close all open/close all

CDS information : Oligo_00070


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction10,933 / 11,271 / + [in whole cluster]
10,933 / 11,271 / + [in contig]
Location10933..11271 [in whole cluster]
10933..11271 [in contig]
TypeCDS
Length339 bp (112 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productcytochrome P450 family protein
Product (GenBank)P450-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Related Reference
ACC
Q59831
PmId
[7557483] Cloning, characterization and expression of the gene encoding cytochrome P-450sca-2 from Streptomyces carbophilus involved in production of pravastatin, a specific HMG-CoA reductase inhibitor. (Gene. , 1995)
Family/Domain
FD
IPR001128

close this sectionSequence

selected fasta
>cytochrome P450 family protein [P450-like protein]
MEVGGQTIRAGEGVLCTLSTANRDEGAFTDPDELDLRRDARSHLSFGFGIHQCIGQSLAR
AEPQIALETLLRRLPGLRLAASFEELRFRDGVGFYGVKELPDPCPALPPDRP
selected fasta
>cytochrome P450 family protein [P450-like protein]
GTGGAGGTCGGCGGGCAGACGATCAGGGCGGGGGAGGGCGTGCTGTGCACGCTGTCCACC
GCCAACCGCGACGAGGGGGCGTTCACCGACCCCGATGAGCTGGACCTGCGGCGCGACGCC
CGCAGCCACCTGAGCTTCGGGTTCGGGATCCATCAGTGCATCGGCCAGTCGCTGGCCCGC
GCCGAACCGCAGATCGCCCTGGAGACACTGCTGCGCAGGCTCCCGGGGCTGCGACTGGCG
GCCTCCTTCGAGGAGTTGCGGTTCCGGGACGGGGTCGGGTTCTACGGGGTCAAGGAGCTG
CCGGACCCCTGTCCCGCACTGCCGCCGGACCGGCCCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [1-101]  2.10000267834031e-29 SSF48264
SSF48264   Cytochrome_P450
 [1-73]  7.30000000000002e-11 PF00067
PF00067   p450
 [1-101]  4.70000000000001e-32 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [23-38]  2.00000075217457e-11 PR00359 [44-53]  2.00000075217457e-11 PR00359 [53-64]  2.00000075217457e-11 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [46-55]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit