close all open/close all

CDS information : Oligo_00090


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction29,924 / 44,446 / + [in whole cluster]
29,924 / 44,446 / + [in contig]
Location29924..44446 [in whole cluster]
29924..44446 [in contig]
TypeCDS
Length14,523 bp (4,840 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)
Gene
Gene (GenBank)olmA2
EC number
Keyword
Note
Note (GenBank)
  • modular polyketide synthase
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
not conserved YASHS
5 methylmalonyl-CoA
6 malonyl-CoA
KS33..401
AT561..883
KR1125..1291
ACP1377..1447
KS1468..1838
AT2005..2320
KR2654..2834
ACP2936..3006
KS3029..3405
AT3584..3899
DH3951..4097
KR4401..4581
ACP4686..4756

close this sectionSequence

selected fasta
>polyketide synthase
MDDDKLVDYLKRVTADLKRTRQRVQELEAGAAEPIAVVSMGCRFPGGIASPEDLWECVRT
GTDTISGFPTDRGWRTGHLRGDFRLAGGFLADAAGFDAGLFGISPREALAMDPQQRLLLE
TSWEVLERAGLDPTTVRGADGGVFVGMADQKYGPRDGELLDQVKGLVLTGTTSSVASGRI
AYSLGLQGPAITIDTACSSSLVALHLAVRALRSGECSFALVGGAAVMAEPQLFAEMAEQG
GMAGDGRCKAFAAAADGTGWGEGVGVLLLQPLSTAREQGLPVLATVRGTAVNQDGASNGL
TAPNGPAQRRVIRKALADAQLSVGQVDAVEAHGTGTRLGDPIEAGALLATYGQDRAGDEP
LWLGSVKSNIGHTQAAAGMAGVIKMVLAMRHGLLPRTLHVDEPTPQVDWSAGAVRLLTEE
QTWPSTGRPRRSAVSSFGISGTNAHVVLEHDPAASGADGAPEPGPDTSPAAPVPWTLSAA
SEEALRAQARRLHRYADGDPGRRPLDIARSLARGRARLAHRAVVLGADRTELLTSLAALG
AGEPDPRVVRGRTVPSGPVAFLFTGQGSQRAGIGRELYETFPVFARAFDEVRDRLDPQLA
HPLDDILDGRVVDGLPLIEQTGYALAAVFALEVALFRLVEHAGVVPDFVLGHSTGELAAA
HCAGVLSLDDACTLVAARGRFVQTLRTDGAMVAVETSETELAELIARADVGDRATIAVVN
GPRSVVVSGDADAVERVRARCEERGRKTRKLPISHAAHSVHMEPMLARLREVAEGLEHRP
PRIPMVSNLTGAPVPPEANWPEYWVRQVRETVRFHDGIRWLGAQGVTACLELGPGGALIA
MARESLGDPGREVALVPTLQHDRPEPATFLSALAELHVHGVAVDWDTPLAARGATSTDLP
TYAFQRERYWLPATPAAPRTAEPADRTGRVRYRVGWTPYPDVDTDARPTGTWLVVAPDGD
SDGDGHGDGARVAEALGERAVLLTAGPGLAPALARLPEDRPVAGVLALPAESATRWTRLA
PRSALRGRGARPASVRHQAPVSVDTEAVPGAAPALLWGLGRVPHSGGGVVDLPAGLDARS
LRLLAAVLAAPGDQDELAVRPGGVFARKLLPAQRPRRQRAWRTGGTVLITGDIAGVTPEL
LQYLSGGGARTLLLAHRPGTPLPDAAVLAAAGGPCTVTEWDLGPLETASVTAVVHLSGID
PDGPSTPDALTAAGPARAVQDRLRTVVRLEELFHDADLDAFVLLSTVAGTWGGAEDLVHT
VAHAALESLAERRTLDGRPGTCVGWGPWETPADTGASPVPGLLPLPADLAVSALAEALDA
DDPVCAVVDVDWSLFHPVLTGRGPRPLVADLPEVRALPAPPTAEVVLAPAADREHQLLEL
VRAQAAAVLGHASGAAIDPVRPFRDLGFESLAAVRFRDRVAAETGLRLPATLVFDHPTAQ
AVAAHLLAELSGVRQHEDEVAPTADHDDPIAIVGMACRYPGGVRGPEDLWDLVHCGRDGV
GDFPTDRGWDLPALRRLAPDLAMKGGFLPDAADFDAAFFGISPREATAMDPQQRLLLEVS
WQALEGAGLDPAALRGSRTGVFAGAAGSDYGVVLEGAPEADGYLTTGTAASVISGRIAYT
LGLHGPAVTVDTACSSSLVALHMAVGALHQGECDLALATGVSVISTPGAFVDFARQSGLA
ADGRCKAFAASADGTNWAEGVGVLVVERLSDARRNGHRVLATVRGSAVNSDGASNGLSAP
NGGAQQRVIRQALAAAGLSADDVDAVEAHGTGTTLGDPIEAQAVLATYGRDRPAGQPLWL
GSLKSNIGHSGAAAGVGGVIKMVQALRHGVLPRTLHVDEPTPEVDWSAGTVGLLTENREW
PHTGKPRRVGVSAFGVSGTNAHVVLEQGPEETPEEAPEEAPEETPGEAPGATAPPLLPWV
LSARTPEALRAQAARLAARLAERELPAAAVGHALLTSRSDFEHRAVALGAGHGELTEALR
AIAAGEPAGSTVTGVARRAAGRGPVFVFPGQGGQWPGMAAELLDTAPEFAARWAECERAL
APYTGFSVTELVRSGTPLERVDVVQPVLFAVMVSLAALWRSYGVVPAAVAGHSQGEIAAA
CVAGALSLDDAARVVALRAQALRALVGEGGMVSVGIPLAEAERWLPRWDGQVSVAAVNGP
SAVVFSGAPAALDDLVAHARDQDVRVRRIDVDYASHSAQVERIEDEIMTALGPVRPGPGQ
IPFFSTVTADWQDPTGLDAAYWYRNLREPVLLEPSVTALAEQGYDVFVEVSPHPVLGAAL
TETAELAGAEPVVTGTLRRDEGGLKRVRTALAELWTHGVPVDWTPAFPGRHGTPVELPAY
PFQRTRYWPAARPAVAQDPQDERFWQAVDQQDLPTLAGTLGLADEQPLRELVPALSAWRR
DRKERAAVESWRYRIEWRRLPEPERRTLPGTWLLVVPTGTGTTDEPLTGTGTTDEPVTGA
TTGGTADDPVTAAVTALLRERAEQLVVLAVDPGSDPTTLATALRGALGGTEPAGVVSLTG
IDGSPHPERPVVPAGAALSLALLRALADARVTAPLWCLTHGAVTTDDDAGPVHPEQAAVW
ALGRVAALEFPGTWGGLVDLPDPLDDRTADRLAAVLAGLDGEDQVALRPSGVFGRRLVRA
TPRATAGTGWRPRGTVLVTGGTGALGRRVARWLAREGAEHLVLTSRRGPLAPGADALVTE
LTGLGVKVTLLSCDLADPAQVTAMVAEAQRDGDPIGAVVHTAGGGGLGPLAEAGPDDLAE
AMAAKVTGIAHLEAALDPEQLDAVVYFSSISASWGAGDHGVYAAANGVLDARAEARSAAG
VHTVSLAWAPWAGGGMADDPVFDTLSRKGLPLIDPDLAVSALAAVLAEGESSLLLVDVDW
ERFTPQFTFERPTRLLTELPEARPEPATDDTAPDTAASPLAQRLAALTGPQRTAALRDLV
REQAAAVLGHADARSVDPARALKELGFDSLTAVELRNRLSTATGLRLPATMVFDHPTIAE
LADFLARGLTPEAAVPAEPATVVRVDQDDPIAIVAMACRYPGDVASAEDLWRAVRDEADL
ITPFPTDRGWPLGRLVDAADPDRPGTSYVGHGGFLHGAGDFDPGFFGISPREAQAMDPQH
RLLLESSWEALERAGIAPRSLRGSRTGVYVGLTDQAYGTRLRGSTDGMEGYLVSASANVA
SGRISYSLGFQGPALTVDTACSSSLVALHLAAQALRDGECDLAIAGGATVMPDPTSFVAF
SRQRGLAADGRCKPFAAAADGFSLGEGAGVLLVERLSDARRLGHPVLAVVRGSAVNQDGA
SNGLTAPNGPAQERVIRQALVNAALPASAVDVVEAHGTGTTLGDPIEAQALLATYGQDRP
AGRPLRLGSVKSNIGHSQAAAGVAGVIKMVQAMRHGLMPRTLHVDAPSPHVDWSSGAVEL
LDRAQEWPRDGAPRRAGVSAFGISGTNAHVILEEAPDTLEEAPDEPAGESTDERADEPTD
ERADTDTGRPAPGVSVPTAGRPVPVVVSARTQDALRDQAARLTALLDEGGHGVTDLAHSL
ATTRSVLDRAAVLVAADPDELRRGLTDLSAGAVAEERAEGRLAFLFTGQGAQRTGMGRAL
YAAFPAFASAFDELCAALDRHLPRPLASVVFAEPGSPEAALIDQTLYTQPALFAVEVALF
RLLEHWGVRPDAVLGHSIGELAAAHVAGVWSTADAARVVTARARLMQELPEGGAMLSVAA
AEDVVSALLGDAFDEVSVAAVNGPASMVLSGTEEAVTAAGARLAEAGLRTKRLTVSHAFH
SPLMEPMLAAYERELAQVTFAEPELPVVSNVTGKPATAEQLCDPAYWARQVRGTVRFADG
VDSLLGEEVTTFLELGPDGVLTAMAKESAGAGATGIAVQRRDRDEVRTLLTALGRLHVRT
GRVDWPAFFHGTGARRVELPTYAFQHRRYWLDAPTGGVEALAGAGLAGTGHPLLTAAVPL
PGTGGSLFSGSLPGIDEERPPSRGDILDLVLWAAGSLGCDRIAELDVPAALPGGPHAPLQ
LVVAAPDEDGDRDFTLHVGPTDSGDAGDESWTRIAHGTVGGAAARPEPDPAAWPPADAEP
VGADAVWRRADELFAELVLTEQEAGDADRFGLHPELLAGLTDLITELAGEPVHFAGVTRY
ATGATELRVRLTRSGPGAVAVLLSDAEGEPVLSVDRVGVRTGTAPATTPAGAPTGPDSLY
RLTWTPVAAVAPEPAGPWAVVGADGLAKALVATQGAEVEAHPDLASLGRSTEHGAAPGLV
VLSVDTEPGATVESMRHTTHRTLELVKELLADGRLAGARFVLVTRAAVSTGDGTPVDPAQ
AAARGLLLSAQAEHPERFVLADLGGRDADAELLAAAVGTALTEAEPQLAVRDGQVLVPRL
AQVTERPTDGPAERGPGGEHGTVVVTGATGGIGTEIVRHLATAHGVRHLLLLSRRGPDDP
RAAELGRVLAEAGADATFTACDTADRAALADALADVPAEHPVTAVVHIAGVVDDGVLTTL
TPDRIDTVLRPKAEAAQHLHELTADLGLSHFVLFSSGVGTFGGAGQANYAAANAFLDALA
HRRRAADLPATSLAWGLWETTAGMSAHLSDVDRRRMAQAGVLAFTPRQGLALFDAAWNSD
ATTLVPMRLDKAVLRGKAAEATLPAPFRGLVRAPLRRASAAGARAAGQSFAQQLAEQSES
GRRQLLLDLIHRQVAAVLDYAADAPLDAKLPFRELGFDSLTAVELRNGLIAATGVQLSAA
LVFDYPTATALAEHLESKVLRSVAGAPLPALTQLDHLEAALATSPPDRATREQLAARLRR
LASAWSADELEADDGDITSKLDSASDEELFDFINAEFGKD
selected fasta
>polyketide synthase
GTGGATGACGACAAGCTCGTCGACTATCTCAAGCGGGTCACCGCGGACCTGAAGCGGACC
CGGCAGCGGGTGCAGGAACTGGAGGCGGGCGCCGCCGAACCCATCGCCGTCGTCTCGATG
GGCTGCCGCTTCCCGGGCGGCATCGCCTCCCCGGAGGACCTGTGGGAGTGCGTGCGCACC
GGCACCGACACCATCTCCGGGTTCCCCACCGACCGCGGCTGGCGCACCGGCCACCTGCGC
GGCGACTTCCGCCTCGCGGGCGGCTTCCTCGCCGACGCGGCCGGTTTCGACGCCGGGCTG
TTCGGCATCTCGCCGCGTGAGGCGCTGGCGATGGACCCGCAGCAGCGGCTGCTCCTGGAG
ACCTCCTGGGAGGTCCTGGAGCGGGCGGGCCTCGACCCCACCACGGTGCGCGGCGCCGAC
GGCGGGGTGTTCGTCGGCATGGCCGACCAGAAGTACGGCCCGCGCGACGGTGAACTCCTC
GACCAGGTCAAGGGCCTGGTCCTGACCGGCACCACCAGCAGCGTCGCCTCCGGCCGGATC
GCCTACTCGCTCGGCCTCCAGGGGCCCGCGATCACCATCGACACCGCCTGCTCCTCCTCC
CTGGTCGCCCTGCACCTCGCGGTACGGGCCCTGCGCTCGGGGGAGTGCTCGTTCGCGCTC
GTCGGCGGTGCCGCGGTGATGGCGGAACCCCAGCTGTTCGCCGAGATGGCGGAGCAGGGC
GGGATGGCGGGCGACGGCCGCTGCAAGGCGTTCGCCGCGGCGGCCGACGGCACCGGCTGG
GGCGAGGGCGTCGGCGTGCTCCTGCTCCAGCCGCTGTCCACGGCCCGGGAACAGGGCCTG
CCCGTCCTGGCCACCGTCCGCGGCACGGCCGTCAACCAGGACGGCGCCTCCAACGGACTG
ACCGCGCCCAACGGTCCCGCCCAGCGCCGCGTCATCCGCAAGGCCCTCGCCGACGCCCAG
CTCAGCGTCGGCCAGGTCGACGCGGTCGAGGCGCACGGCACCGGAACCCGGCTCGGCGAC
CCCATCGAGGCGGGGGCCCTGCTGGCCACCTACGGCCAGGACCGGGCCGGGGACGAGCCG
CTGTGGCTCGGCTCGGTCAAGTCGAACATCGGTCACACGCAGGCCGCGGCCGGCATGGCC
GGAGTCATCAAGATGGTGCTGGCGATGCGGCACGGACTGCTGCCGCGCACCCTGCACGTG
GACGAACCCACACCCCAGGTCGACTGGTCGGCGGGCGCCGTACGGCTGCTGACGGAGGAA
CAGACCTGGCCGAGCACCGGCCGGCCGCGCCGCTCGGCCGTCTCCTCCTTCGGCATCAGC
GGTACCAACGCCCACGTCGTCCTCGAACACGACCCCGCCGCGAGCGGCGCGGACGGCGCA
CCCGAGCCCGGCCCCGACACCTCGCCCGCCGCCCCCGTCCCGTGGACGCTGTCCGCCGCG
AGCGAGGAGGCGCTGCGCGCCCAGGCACGGCGGCTGCACCGGTACGCCGACGGCGACCCC
GGACGGCGCCCGCTGGACATCGCCCGATCCCTGGCCCGTGGCCGCGCCCGGCTCGCGCAC
CGCGCCGTCGTGCTCGGCGCCGACCGCACCGAACTCCTCACGTCCCTGGCCGCCCTCGGC
GCGGGCGAGCCCGACCCCCGCGTCGTACGCGGCCGGACCGTGCCGAGCGGCCCCGTCGCC
TTCCTGTTCACCGGCCAGGGCTCGCAGCGGGCGGGCATCGGGCGGGAACTGTACGAGACC
TTCCCGGTGTTCGCCCGCGCCTTCGACGAGGTGCGCGACCGGCTCGACCCGCAACTCGCC
CACCCGCTCGACGACATCCTCGACGGGCGCGTCGTGGACGGACTGCCGCTGATCGAGCAG
ACCGGGTACGCGCTCGCCGCGGTGTTCGCGCTGGAGGTCGCGCTGTTCCGGCTGGTCGAA
CACGCCGGTGTCGTCCCCGACTTCGTCCTCGGGCACTCCACCGGCGAGCTGGCCGCCGCG
CACTGCGCCGGGGTGCTCTCGCTGGACGACGCCTGCACCCTCGTCGCGGCGCGCGGCCGG
TTCGTGCAGACCCTGCGCACCGACGGCGCGATGGTCGCCGTCGAGACCTCCGAGACGGAA
CTCGCCGAACTCATCGCGCGGGCCGACGTCGGCGACCGGGCGACCATCGCCGTGGTGAAC
GGACCCCGGTCCGTGGTGGTCTCCGGTGACGCGGACGCCGTCGAGCGGGTGCGCGCCCGG
TGCGAGGAGCGCGGGCGCAAGACGCGCAAGCTGCCCATCAGCCACGCCGCGCACTCCGTC
CACATGGAACCGATGCTGGCGCGGCTGCGCGAGGTCGCCGAGGGCCTCGAACACCGCCCG
CCCCGCATCCCCATGGTCTCCAACCTGACCGGCGCACCCGTCCCGCCCGAGGCGAACTGG
CCGGAGTACTGGGTCCGCCAGGTCCGCGAGACGGTGCGCTTCCACGACGGCATCCGCTGG
CTCGGCGCCCAGGGCGTCACCGCCTGCCTCGAACTGGGGCCCGGCGGAGCGCTCATCGCG
ATGGCGCGCGAGAGCCTCGGCGACCCGGGCCGCGAGGTGGCCCTCGTCCCCACCCTCCAG
CACGACCGGCCCGAGCCGGCCACGTTCCTGTCCGCGCTGGCCGAACTGCACGTGCACGGC
GTGGCCGTCGACTGGGACACCCCGCTCGCCGCCCGCGGCGCGACCAGCACCGACCTGCCC
ACCTACGCCTTCCAGCGCGAGCGCTACTGGCTGCCCGCCACCCCCGCGGCACCACGCACC
GCCGAACCGGCCGACCGGACCGGACGCGTGCGCTACCGGGTCGGCTGGACGCCGTACCCG
GACGTCGACACCGACGCGCGGCCGACCGGCACCTGGCTGGTCGTCGCCCCCGACGGCGAC
AGCGACGGTGACGGTCACGGCGACGGAGCGCGGGTCGCCGAGGCCCTGGGGGAGCGGGCG
GTGCTGCTGACCGCCGGGCCCGGCCTCGCTCCCGCCCTCGCGCGGCTGCCCGAGGACCGG
CCCGTCGCGGGCGTGCTCGCGCTTCCCGCGGAGTCCGCGACCCGCTGGACCCGCCTGGCC
CCTCGTTCAGCCCTCCGAGGCCGGGGTGCGCGCCCCGCCAGTGTACGCCACCAGGCGCCC
GTCTCCGTCGACACCGAGGCCGTGCCCGGTGCCGCCCCAGCCCTCCTGTGGGGGCTCGGC
CGGGTCCCGCACTCCGGCGGCGGCGTGGTGGACCTGCCCGCCGGCCTCGACGCGCGCTCC
CTGCGGCTGCTCGCGGCCGTCCTCGCCGCACCCGGCGACCAGGACGAACTCGCCGTACGG
CCGGGCGGCGTCTTCGCCAGGAAGCTGCTGCCCGCCCAGCGCCCCCGGCGGCAGCGTGCC
TGGCGCACCGGCGGAACCGTCCTGATCACCGGGGACATCGCGGGCGTCACACCGGAACTC
CTCCAGTACCTCTCCGGCGGCGGCGCTCGCACGCTCCTGCTGGCGCACCGCCCCGGCACG
CCCCTGCCCGACGCCGCCGTCCTCGCCGCGGCGGGCGGACCGTGCACCGTCACCGAGTGG
GACCTGGGCCCGCTGGAGACGGCGTCGGTGACCGCCGTCGTCCACCTCAGCGGCATCGAC
CCGGACGGCCCGTCCACGCCGGACGCCCTCACCGCCGCCGGGCCGGCCCGCGCCGTCCAG
GACCGGCTGCGTACCGTCGTACGGCTCGAAGAGCTGTTCCACGACGCGGACCTGGACGCC
TTCGTGCTGCTGTCCACCGTCGCCGGCACCTGGGGCGGCGCCGAGGACCTCGTGCACACC
GTCGCGCACGCCGCCCTGGAGTCCCTCGCCGAGCGCCGCACCCTCGACGGCCGCCCCGGC
ACCTGCGTCGGCTGGGGCCCCTGGGAGACACCGGCGGACACGGGGGCGTCACCGGTCCCC
GGCCTGCTGCCGCTCCCCGCCGACCTCGCCGTGTCCGCGCTGGCCGAGGCCCTGGACGCC
GACGACCCCGTCTGCGCCGTCGTCGACGTCGACTGGAGCCTGTTCCACCCCGTCCTCACC
GGGCGCGGCCCCCGCCCGCTCGTCGCCGACCTGCCCGAGGTCCGCGCCCTGCCCGCACCC
CCGACCGCCGAAGTGGTCCTCGCGCCCGCCGCCGACCGGGAACACCAACTCCTCGAACTG
GTCCGGGCGCAGGCCGCCGCCGTGCTCGGCCACGCCTCCGGCGCCGCCATCGATCCCGTA
CGCCCGTTCCGCGACCTCGGCTTCGAGTCCCTGGCGGCCGTACGGTTCCGCGACCGCGTC
GCCGCCGAGACCGGGCTGCGGCTGCCCGCCACCCTCGTCTTCGACCACCCCACCGCGCAG
GCGGTCGCCGCACATCTGCTGGCCGAACTGTCCGGCGTACGACAGCACGAGGACGAGGTC
GCCCCGACGGCCGACCACGACGACCCGATCGCCATCGTCGGCATGGCCTGCCGCTACCCC
GGCGGCGTACGCGGACCCGAGGACCTGTGGGACCTCGTCCACTGCGGACGCGACGGCGTC
GGCGACTTCCCCACCGACCGCGGCTGGGACCTGCCCGCCCTGCGCCGCCTGGCACCGGAC
CTCGCCATGAAGGGCGGATTCCTGCCCGACGCCGCCGACTTCGACGCCGCCTTCTTCGGC
ATCTCCCCGCGTGAGGCGACCGCGATGGACCCCCAGCAGCGACTGCTCCTGGAGGTGTCC
TGGCAGGCCCTGGAGGGCGCGGGCCTCGACCCGGCGGCCCTGCGCGGCAGCCGCACCGGA
GTCTTCGCCGGCGCCGCGGGCTCGGACTACGGCGTGGTGCTGGAAGGGGCCCCGGAGGCG
GACGGATACCTGACCACCGGCACCGCCGCGAGCGTCATCTCCGGCCGGATCGCCTACACC
CTCGGCCTGCACGGGCCCGCGGTCACCGTGGACACGGCGTGCTCCTCCTCACTGGTGGCC
CTGCACATGGCCGTGGGCGCCCTGCACCAGGGTGAGTGCGACCTCGCGCTCGCCACCGGC
GTCTCCGTCATCTCCACGCCGGGCGCGTTCGTCGACTTCGCCCGGCAGAGCGGGCTCGCC
GCCGACGGCCGCTGCAAGGCGTTCGCCGCGAGTGCCGACGGCACCAACTGGGCCGAGGGC
GTGGGCGTCCTGGTCGTGGAGCGGCTCTCCGACGCGCGGCGCAACGGACACCGCGTCCTC
GCCACGGTCCGGGGCAGCGCCGTCAACTCCGACGGCGCCTCCAACGGGCTCTCCGCGCCC
AACGGCGGAGCACAGCAGCGGGTGATCCGGCAGGCGCTGGCCGCCGCCGGACTGTCCGCC
GACGACGTCGACGCCGTCGAGGCGCACGGTACGGGCACGACGCTCGGCGACCCGATCGAG
GCGCAGGCGGTCCTGGCCACCTACGGGCGGGACCGGCCGGCCGGACAGCCGCTGTGGCTG
GGGTCGCTCAAGTCCAACATCGGGCACAGCGGGGCCGCGGCCGGGGTCGGCGGCGTGATC
AAGATGGTGCAGGCCCTGCGGCACGGCGTACTGCCGCGAACCCTGCACGTCGACGAGCCG
ACGCCCGAGGTGGACTGGTCGGCGGGGACGGTGGGACTGCTCACCGAGAACCGAGAGTGG
CCGCACACCGGGAAGCCACGCCGGGTGGGGGTGTCGGCGTTCGGAGTCAGCGGCACCAAC
GCACATGTCGTACTGGAACAGGGGCCCGAAGAAACGCCCGAGGAAGCGCCCGAAGAAGCG
CCGGAAGAAACCCCCGGAGAGGCGCCCGGGGCGACCGCCCCACCGCTCCTCCCGTGGGTG
CTCTCCGCCCGCACCCCCGAGGCGCTGCGCGCCCAGGCCGCCCGCCTGGCCGCCCGTCTT
GCCGAGCGGGAGCTGCCCGCCGCCGCCGTCGGGCACGCCCTGCTGACCTCCCGGTCGGAC
TTCGAGCACCGGGCCGTCGCGCTGGGCGCGGGACACGGCGAGCTCACCGAGGCGCTGCGC
GCGATCGCCGCCGGGGAGCCCGCCGGCTCCACGGTCACCGGCGTGGCCCGCCGGGCCGCC
GGACGCGGCCCGGTCTTCGTCTTCCCCGGGCAGGGCGGACAGTGGCCCGGCATGGCCGCC
GAACTCCTCGACACCGCACCGGAGTTCGCCGCCCGCTGGGCCGAGTGCGAGCGCGCCCTC
GCGCCGTACACGGGCTTCTCCGTGACCGAGCTCGTGCGCTCGGGCACGCCCCTGGAGCGC
GTGGACGTCGTCCAGCCGGTGCTGTTCGCGGTCATGGTGTCGCTGGCGGCGCTGTGGCGC
TCGTACGGCGTGGTGCCCGCCGCGGTGGCCGGACACTCGCAGGGCGAGATCGCGGCGGCC
TGCGTGGCCGGGGCGCTGTCCCTGGACGACGCGGCGCGCGTGGTCGCGCTGCGCGCCCAG
GCGCTCCGCGCGCTCGTCGGCGAGGGTGGCATGGTCTCCGTCGGCATCCCCCTCGCCGAG
GCCGAGCGGTGGCTGCCGCGCTGGGACGGACAGGTCTCCGTCGCGGCCGTCAACGGCCCC
TCCGCGGTGGTGTTCTCCGGCGCACCCGCCGCCCTGGACGACCTGGTGGCCCACGCCCGC
GACCAGGACGTCCGGGTCCGGCGCATCGACGTCGACTACGCCTCGCACTCCGCGCAGGTG
GAGCGGATCGAGGACGAGATCATGACCGCCCTCGGCCCGGTCCGGCCGGGGCCGGGACAG
ATCCCGTTCTTCTCCACCGTGACCGCCGACTGGCAGGACCCCACCGGCCTCGACGCCGCC
TACTGGTACCGCAACCTGCGCGAACCGGTGCTCCTCGAACCGTCCGTCACCGCCCTGGCC
GAGCAGGGCTACGACGTCTTCGTCGAGGTCAGCCCGCACCCGGTGCTCGGCGCCGCACTC
ACCGAGACCGCCGAACTGGCCGGAGCGGAACCGGTGGTGACGGGCACCCTGCGCCGCGAC
GAGGGCGGTCTGAAGCGCGTACGCACGGCACTGGCCGAACTGTGGACGCACGGCGTCCCC
GTGGACTGGACGCCCGCCTTCCCCGGCCGGCACGGCACACCGGTGGAACTGCCCGCCTAC
CCCTTCCAGCGCACCCGCTACTGGCCGGCGGCCCGCCCGGCGGTGGCCCAGGACCCGCAG
GACGAGCGGTTCTGGCAGGCCGTGGACCAACAGGACCTGCCCACCCTGGCCGGCACGCTC
GGCCTCGCCGACGAACAGCCGCTGCGCGAGCTCGTACCGGCCCTGTCCGCCTGGCGGCGC
GACCGCAAGGAGCGGGCCGCCGTCGAGTCCTGGCGCTACCGCATCGAGTGGCGCCGGCTG
CCCGAGCCGGAGCGCCGTACGCTGCCCGGCACCTGGCTCCTCGTGGTGCCGACCGGGACC
GGGACCACGGACGAACCGTTGACCGGGACCGGGACCACGGACGAGCCGGTGACCGGCGCC
ACCACCGGCGGCACCGCGGACGACCCGGTGACCGCCGCCGTCACCGCCCTCCTGCGGGAA
CGCGCCGAACAGCTCGTGGTGCTCGCCGTCGACCCCGGCTCCGACCCCACCACCCTGGCC
ACCGCCCTCCGCGGCGCCCTCGGCGGCACGGAGCCGGCCGGTGTGGTCTCGCTGACCGGC
ATCGACGGTTCGCCGCACCCGGAGCGGCCCGTCGTCCCGGCGGGCGCGGCGCTCAGCCTC
GCCCTGCTGCGGGCGCTCGCCGACGCCCGGGTCACCGCGCCCCTGTGGTGCCTGACCCAC
GGCGCCGTCACCACCGACGACGACGCCGGACCGGTCCACCCCGAACAGGCCGCCGTATGG
GCCCTCGGCCGGGTCGCCGCGCTCGAGTTCCCGGGCACCTGGGGCGGCCTCGTCGATCTG
CCCGACCCCCTCGACGACCGCACGGCGGACCGTCTCGCGGCGGTGCTCGCGGGCCTCGAC
GGCGAGGACCAGGTGGCGCTGCGCCCGTCGGGCGTCTTCGGCCGCCGCCTCGTACGCGCC
ACCCCGCGCGCCACGGCCGGCACGGGCTGGCGGCCGCGCGGCACCGTGCTCGTGACCGGT
GGCACCGGAGCGCTCGGCCGGCGGGTCGCCCGCTGGCTGGCCCGCGAGGGCGCGGAACAC
CTCGTCCTCACCAGTCGGCGCGGCCCGCTCGCACCCGGCGCCGACGCGCTCGTCACCGAA
CTCACCGGGCTCGGCGTCAAGGTCACCCTGCTCTCTTGCGACCTCGCCGATCCGGCCCAG
GTGACCGCGATGGTCGCCGAGGCGCAGCGCGACGGCGACCCGATCGGCGCCGTGGTGCAC
ACCGCGGGCGGCGGCGGGCTCGGCCCGCTGGCCGAGGCCGGGCCCGACGACCTGGCCGAG
GCGATGGCCGCCAAGGTGACCGGCATCGCCCACCTGGAAGCGGCCCTGGACCCCGAACAG
CTCGACGCCGTCGTCTACTTCTCCTCCATCAGCGCCTCCTGGGGCGCCGGCGACCACGGC
GTCTACGCCGCCGCCAACGGCGTGCTCGACGCCCGTGCCGAGGCCCGCAGCGCGGCCGGC
GTGCACACCGTGTCCCTCGCCTGGGCGCCCTGGGCGGGCGGCGGCATGGCCGACGACCCG
GTCTTCGACACCCTCTCCCGCAAGGGCCTGCCCCTCATCGACCCGGACCTCGCCGTCTCC
GCGCTCGCCGCGGTGCTCGCGGAGGGCGAGTCCTCGCTGCTGCTCGTCGACGTCGACTGG
GAGCGGTTCACCCCGCAGTTCACCTTCGAGCGGCCCACCCGCCTCCTGACCGAACTGCCC
GAGGCCCGCCCCGAACCGGCCACCGACGACACCGCGCCCGACACCGCCGCCTCCCCGCTC
GCCCAACGGCTGGCCGCACTGACCGGACCCCAGCGCACGGCGGCCCTGCGCGACCTGGTG
CGCGAACAGGCCGCGGCCGTACTCGGCCACGCCGACGCACGGTCCGTCGACCCCGCCCGC
GCGCTCAAGGAGCTCGGCTTCGACTCGCTCACCGCGGTCGAACTGCGCAACCGGCTGAGC
ACCGCGACCGGCCTCAGGCTGCCCGCCACCATGGTCTTCGACCACCCGACCATCGCCGAA
CTGGCGGATTTCCTGGCCCGCGGCCTCACCCCCGAGGCCGCCGTACCGGCCGAACCCGCC
ACCGTCGTACGCGTCGACCAGGACGACCCGATCGCCATCGTCGCGATGGCCTGCCGCTAC
CCCGGCGACGTCGCCTCCGCCGAGGACCTGTGGCGCGCCGTGCGCGACGAGGCCGACCTG
ATCACCCCGTTCCCCACCGACCGCGGCTGGCCGCTCGGCCGACTCGTCGACGCCGCCGAC
CCCGACCGGCCGGGCACCAGCTACGTCGGCCACGGCGGATTCCTGCACGGCGCGGGCGAC
TTCGACCCGGGCTTCTTCGGCATCTCGCCGCGCGAGGCCCAGGCCATGGACCCGCAGCAC
CGGCTGCTGCTCGAATCGTCCTGGGAGGCGCTGGAACGCGCGGGCATCGCCCCGAGGTCG
CTGCGCGGCAGCAGGACCGGGGTGTACGTCGGTCTGACCGACCAGGCCTACGGGACCCGG
CTGCGCGGCTCCACCGACGGCATGGAGGGCTACCTCGTCAGCGCGTCCGCCAACGTCGCC
TCCGGGCGGATCTCGTACTCGCTCGGCTTCCAGGGACCCGCGCTCACCGTGGACACGGCC
TGCTCCTCCTCGCTGGTCGCGCTGCACCTGGCCGCGCAGGCGCTGCGGGACGGCGAGTGC
GACCTGGCGATCGCGGGCGGTGCCACCGTCATGCCGGACCCCACCTCCTTCGTGGCGTTC
AGCCGGCAGCGCGGACTGGCCGCCGACGGCCGCTGCAAGCCGTTCGCCGCCGCCGCGGAC
GGGTTCTCGCTCGGTGAGGGCGCCGGTGTGCTGCTCGTGGAGCGGCTGTCCGACGCCCGC
CGGCTCGGACACCCGGTCCTCGCGGTGGTCCGCGGCTCCGCGGTGAACCAGGACGGCGCG
TCCAACGGCCTCACCGCGCCCAACGGCCCCGCCCAGGAGCGGGTCATCCGGCAGGCGCTG
GTCAACGCGGCGCTGCCCGCCTCGGCCGTGGACGTGGTCGAGGCGCACGGTACGGGCACG
ACGCTCGGCGACCCGATCGAGGCACAGGCGCTGCTCGCCACCTACGGCCAGGACCGCCCG
GCCGGCCGGCCGCTGCGGCTGGGCTCGGTCAAGTCCAACATCGGGCACAGCCAGGCCGCC
GCGGGCGTCGCCGGAGTCATCAAGATGGTGCAGGCGATGCGGCACGGACTGATGCCCCGC
ACCCTGCACGTGGACGCCCCGAGTCCGCACGTCGACTGGAGTTCCGGGGCGGTGGAACTG
CTCGACCGGGCCCAGGAGTGGCCACGGGACGGCGCACCGCGCCGCGCGGGCGTCTCGGCG
TTCGGGATCAGCGGCACGAACGCGCACGTGATCCTGGAGGAGGCACCCGACACCCTGGAG
GAGGCACCCGACGAGCCCGCCGGCGAGTCCACCGACGAGCGGGCCGACGAGCCCACCGAC
GAGCGGGCCGACACGGACACCGGGCGCCCCGCCCCCGGCGTCTCCGTCCCCACCGCCGGC
CGCCCCGTCCCCGTCGTCGTCTCCGCCCGCACCCAGGACGCCCTCCGTGACCAGGCCGCC
CGGCTGACCGCCCTCCTCGACGAGGGCGGGCACGGCGTCACCGATCTCGCCCACTCCCTG
GCCACCACCCGCAGCGTCCTCGACCGGGCGGCGGTGCTCGTCGCCGCCGACCCGGACGAA
CTGCGCCGCGGCCTCACGGACCTGTCCGCGGGCGCCGTCGCCGAGGAGCGCGCCGAGGGC
CGGCTCGCCTTCCTCTTCACCGGCCAGGGCGCCCAGCGCACCGGCATGGGCCGCGCCCTG
TACGCGGCCTTCCCGGCGTTCGCGTCGGCCTTCGACGAGCTGTGCGCCGCCCTCGACCGC
CATCTGCCGCGCCCGCTGGCCTCGGTCGTGTTCGCCGAGCCCGGCTCGCCCGAGGCCGCG
CTGATCGACCAGACCCTCTACACACAGCCGGCCCTGTTCGCCGTGGAGGTGGCGCTGTTC
CGGCTGCTGGAGCACTGGGGCGTACGGCCCGACGCCGTGCTCGGCCACTCGATCGGCGAG
CTCGCCGCCGCGCACGTGGCCGGCGTCTGGTCCACCGCCGACGCGGCCCGGGTGGTCACC
GCCCGCGCCCGGCTGATGCAGGAACTGCCCGAGGGCGGCGCCATGCTGTCCGTCGCCGCG
GCCGAGGACGTGGTGTCCGCGCTGCTCGGCGACGCGTTCGACGAGGTGTCCGTCGCCGCC
GTCAACGGCCCGGCCTCGATGGTGCTGTCCGGCACGGAGGAGGCCGTCACGGCGGCGGGT
GCCCGGCTCGCCGAGGCGGGGCTGCGCACCAAGCGGCTCACCGTGAGCCACGCCTTCCAC
TCGCCGCTGATGGAACCGATGCTCGCCGCGTACGAGCGCGAACTGGCCCAGGTGACCTTC
GCCGAGCCCGAACTGCCGGTCGTCTCCAACGTGACCGGCAAGCCGGCCACCGCCGAGCAG
CTGTGCGACCCCGCCTACTGGGCGCGGCAGGTGCGGGGGACCGTGCGGTTCGCGGACGGA
GTGGACAGCCTGCTCGGCGAGGAGGTGACCACCTTCCTGGAGCTGGGCCCGGACGGCGTG
CTGACCGCCATGGCGAAGGAGTCGGCCGGGGCGGGCGCCACCGGCATCGCCGTCCAGCGC
CGCGACCGCGACGAGGTACGGACCCTGCTCACCGCGCTCGGCAGGCTGCACGTGCGCACC
GGCCGCGTCGACTGGCCCGCGTTCTTCCACGGCACCGGCGCCCGCCGGGTGGAACTGCCC
ACGTACGCGTTCCAGCACCGGCGGTACTGGCTGGACGCGCCCACGGGCGGCGTCGAGGCG
CTGGCCGGCGCGGGCCTGGCGGGCACCGGGCACCCGCTGCTCACGGCGGCCGTGCCGCTG
CCCGGTACCGGCGGGTCGCTCTTCAGCGGCAGCCTGCCCGGCATCGACGAAGAACGGCCG
CCGTCCCGCGGCGACATCCTCGATCTGGTGCTGTGGGCGGCCGGCAGCCTCGGCTGCGAC
CGGATCGCCGAACTCGACGTCCCCGCCGCGCTGCCCGGCGGACCGCACGCCCCGCTGCAA
CTCGTGGTGGCGGCGCCGGACGAGGACGGCGACCGGGACTTCACCCTCCACGTGGGGCCC
ACGGACTCCGGTGACGCCGGGGACGAGTCCTGGACGCGGATCGCGCACGGCACCGTCGGC
GGTGCGGCCGCCCGGCCCGAGCCCGACCCCGCCGCCTGGCCGCCCGCCGACGCCGAACCC
GTCGGCGCGGACGCGGTGTGGCGCCGGGCGGACGAGCTGTTCGCCGAGCTGGTGCTGACC
GAGCAGGAGGCGGGCGACGCCGACCGCTTCGGTCTGCACCCCGAGCTGCTGGCGGGCCTG
ACGGACCTGATCACCGAACTCGCCGGCGAGCCGGTCCACTTCGCCGGGGTGACCCGGTAC
GCCACCGGCGCCACCGAGCTGCGGGTCCGGCTGACCCGCTCGGGCCCGGGCGCCGTAGCC
GTGCTGCTGTCGGACGCGGAGGGCGAGCCGGTGCTCTCGGTGGACCGCGTCGGCGTACGG
ACGGGCACCGCGCCCGCCACGACGCCCGCCGGCGCCCCCACCGGACCTGACTCGCTCTAT
CGCCTGACCTGGACACCCGTGGCGGCCGTGGCTCCCGAACCGGCCGGCCCTTGGGCCGTC
GTCGGCGCGGACGGCCTGGCCAAGGCGCTCGTCGCCACCCAGGGCGCCGAAGTCGAGGCC
CACCCGGACCTCGCGTCCCTCGGCCGCTCCACGGAGCACGGCGCCGCGCCCGGGCTCGTC
GTCCTGTCCGTGGACACGGAACCCGGCGCGACCGTCGAGTCCATGCGGCACACCACCCAC
CGCACCCTGGAGCTGGTCAAGGAACTGCTCGCGGACGGCCGCCTGGCCGGGGCCCGGTTC
GTCCTCGTCACCCGCGCGGCCGTGTCCACCGGGGACGGCACCCCGGTCGACCCGGCGCAG
GCGGCGGCCCGCGGACTGCTGCTGTCGGCGCAGGCGGAGCACCCGGAGCGGTTCGTCCTG
GCCGACCTCGGCGGCCGCGACGCGGACGCCGAACTGCTCGCCGCCGCCGTGGGAACCGCA
CTGACCGAGGCCGAACCGCAACTCGCCGTCCGGGACGGCCAGGTGCTCGTGCCCCGGCTG
GCCCAGGTCACCGAACGGCCCACCGACGGTCCGGCGGAACGCGGCCCGGGAGGCGAACAC
GGCACGGTGGTGGTCACCGGCGCGACCGGCGGCATCGGCACCGAGATCGTGCGGCACCTG
GCGACCGCGCACGGCGTGCGGCACCTGCTGCTGCTCAGCAGGCGGGGCCCCGACGACCCG
CGCGCGGCCGAACTGGGCCGAGTCCTTGCCGAGGCGGGCGCCGACGCGACCTTCACGGCC
TGCGACACCGCCGACCGCGCCGCCCTGGCCGACGCGCTGGCGGACGTACCGGCCGAGCAC
CCCGTGACCGCCGTCGTACACATCGCCGGAGTCGTCGACGACGGAGTCCTCACCACCCTG
ACCCCCGACCGGATCGACACCGTGCTGCGGCCCAAGGCCGAGGCGGCGCAGCATCTGCAC
GAGCTGACCGCGGACCTCGGGCTGTCCCACTTCGTGCTGTTCTCCTCGGGCGTCGGCACC
TTCGGCGGCGCGGGCCAGGCCAACTACGCGGCGGCCAACGCCTTCCTGGACGCACTCGCC
CACCGCAGGCGCGCGGCCGACCTGCCGGCGACCTCGCTCGCCTGGGGCCTGTGGGAGACC
ACGGCCGGCATGTCGGCGCACCTCTCCGACGTGGACCGGCGGCGGATGGCCCAGGCCGGC
GTCCTCGCCTTCACCCCGCGGCAGGGTCTCGCCCTGTTCGACGCGGCGTGGAACTCGGAC
GCGACCACCTTGGTACCCATGCGCCTCGACAAGGCCGTACTGCGCGGGAAGGCGGCCGAG
GCGACCCTGCCCGCACCCTTCCGCGGCCTGGTCCGCGCACCCCTGCGCAGGGCCTCGGCG
GCCGGTGCGCGGGCGGCCGGGCAGTCCTTCGCGCAGCAGCTGGCCGAGCAGTCCGAGAGC
GGGCGGCGACAGCTGCTGCTGGATCTGATCCACCGGCAGGTGGCCGCCGTACTGGACTAC
GCGGCCGACGCCCCGCTCGACGCCAAACTCCCCTTCCGGGAGCTGGGATTCGACTCGCTC
ACCGCGGTCGAGCTGCGCAACGGCCTGATCGCCGCGACCGGCGTCCAGCTCTCCGCCGCG
CTCGTCTTCGACTACCCCACGGCGACCGCGCTCGCCGAGCACCTGGAGAGCAAGGTCCTG
CGGTCGGTCGCCGGGGCTCCGCTGCCGGCGCTCACCCAGCTCGACCATCTCGAAGCCGCG
CTCGCCACCTCGCCACCGGACCGGGCCACCCGCGAACAGCTCGCGGCCCGGCTGCGCCGG
CTGGCCTCCGCCTGGAGCGCGGACGAACTCGAAGCCGACGACGGCGACATCACCAGCAAG
CTCGATTCCGCCTCGGATGAAGAGCTCTTCGACTTCATCAACGCGGAATTCGGAAAGGAC
TGA
[4] KS33..401
[4] AT561..883
[4] methylmalonyl-CoA not conserved YASHS755..759
[4] KR1125..1291
[4] ACP1377..1447
[5] KS1468..1838
[5] AT2005..2320
[5] methylmalonyl-CoA2193..2197
[5] KR2654..2834
[5] ACP2936..3006
[6] KS3029..3405
[6] AT3584..3899
[6] malonyl-CoA3777..3781
[6] DH3951..4097
[6] KR4401..4581
[6] ACP4686..4756
[4] KS97..1203
[4] AT1681..2649
[4] methylmalonyl-CoA not conserved YASHS2263..2277
[4] KR3373..3873
[4] ACP4129..4341
[5] KS4402..5514
[5] AT6013..6960
[5] methylmalonyl-CoA6577..6591
[5] KR7960..8502
[5] ACP8806..9018
[6] KS9085..10215
[6] AT10750..11697
[6] malonyl-CoA11329..11343
[6] DH11851..12291
[6] KR13201..13743
[6] ACP14056..14268

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [554-685]  G3DSA:3.40.366.10 [755-872]  G3DSA:3.40.366.10 [1999-2125]  G3DSA:3.40.366.10 [2193-2309]  G3DSA:3.40.366.10 [3576-3709]  G3DSA:3.40.366.10 [3777-3892]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [4401-4566]  4.5e-57 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [2964-2979]  PS00012 [4714-4729]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1380-1446]  3.1e-09 PF00550 [2939-3005]  1.3e-14 PF00550 [4690-4755]  8.5e-09 PF00550
PF00550   PP-binding
 [1370-1484]  2.60000517657733e-26 SSF47336 [2929-3045]  3.30000526807186e-29 SSF47336 [4678-4773]  9.90001804798395e-19 SSF47336
SSF47336   ACP_like
 [1376-1451]  1.70000000000001e-62 G3DSA:1.10.1200.10 [2935-3007]  1.70000000000001e-62 G3DSA:1.10.1200.10 [4684-4759]  1.70000000000001e-62 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1377-1447]  PS50075 [2936-3006]  PS50075 [4686-4756]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1125-1289]  2.3e-18 PF08659 [2654-2833]  5.89999999999994e-55 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [33-275]  1.10000000000001e-79 PF00109 [1468-1712]  1.5e-87 PF00109 [3029-3279]  2.20000000000002e-89 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [283-401]  9e-48 PF02801 [1720-1838]  6.49999999999992e-45 PF02801 [3287-3405]  3.09999999999998e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [561-883]  7.10000000000008e-63 PF00698 [2005-2320]  8.80000000000003e-109 PF00698 [3584-3899]  3.99999999999998e-64 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [2-26]  7.30000000000002e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [558-877]  5.39997012872478e-66 SSF52151 [2003-2304]  2.30000440726534e-64 SSF52151 [3581-3886]  4.60000044330866e-72 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [687-754]  3.39999972437717e-20 SSF55048 [2127-2192]  2.60000517657733e-18 SSF55048 [3711-3776]  2.09999806691534e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-285]  G3DSA:3.40.47.10 [287-450]  G3DSA:3.40.47.10 [1468-1722]  G3DSA:3.40.47.10 [1724-1891]  G3DSA:3.40.47.10 [3031-3291]  G3DSA:3.40.47.10 [3292-3459]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [25-399]  1.59998835313644e-94 SSF53901 [1460-1890]  6.69996745106047e-97 SSF53901 [3021-3403]  1.39999277195148e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1174-1308]  3.09999999999998e-58 G3DSA:3.40.50.720 [2654-2867]  8.60000000000004e-73 G3DSA:3.40.50.720 [4401-4582]  8.60000000000004e-73 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [188-204]  PS00606 [1625-1641]  PS00606 [3192-3208]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [562-863]  2.1000026783403e-114 SM00827 [2007-2301]  1.90000694315261e-116 SM00827 [3585-3883]  1.90000694315261e-123 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1378-1450]  1.99999636034521e-29 SM00823 [2937-3009]  4.19999771339583e-37 SM00823 [4687-4759]  1.29999924468179e-28 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3951-4097]  5.69999708783953e-18 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [35-453]  SM00825 [1470-1890]  SM00825 [3031-3457]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1125-1291]  2.79999889404114e-10 SM00822 [2654-2834]  1.3000049540733e-42 SM00822 [4401-4581]  6.20001486442668e-56 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit