close all open/close all

CDS information : Oligo_00110


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction56,417 / 70,474 / + [in whole cluster]
56,417 / 70,474 / + [in contig]
Location56417..70474 [in whole cluster]
56417..70474 [in contig]
TypeCDS
Length14,058 bp (4,685 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)modular polyketide synthase
Gene
Gene (GenBank)olmA6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)

close this sectionPKS/NRPS Module

12 methylmalonyl-CoA
13 methylmalonyl-CoA
14 methylmalonyl-CoA
KS35..401
AT568..887
kr1187..1368
ACP1473..1543
KS1567..1933
AT2096..2415
KR2714..2891
ACP2996..3066
KS3089..3454
AT3616..3935
kr4242..4423
ACP4530..4600

close this sectionSequence

selected fasta
>polyketide synthase [modular polyketide synthase]
MNSSMSEVVDALRASLLENERLRQQNQRLTTASAEPLAIVGIGCRYPGGVRDTEDLWRLI
TEGRDAMSGFPTDRGWDRWDIPTARTGAFLHDAGDFDPAFFRISPREAMAMDPQQRLLLE
TSWEALERAGIDPATLKGSRTGVFIGGAPQEYGALVMNSAEGAGGYALTGAPGSVLSGRI
SYVLGLEGPAVTVDTACSSSLVALHLAVKSLRTGECDLALAGGVLVLVTPSIFAEFSATG
GSAGDGRCKAFAASADGTGWGEGAGVLAVQRLTDARRDGHPVLAVIRGSAVNQDGASNGL
SAPNGPSQQRVIRQALANAGLSAADVDMVEAHGTGTTLGDPIEAEALLATYGQDRPADRP
LWLGTLKSNIGHTQAAAGVSGVIKAVLSLQHGLLPKTLHVDEPTPQVDWSAGAVELLTQA
REWPETDGPRRAGVSSFGISGTNAHVILEQAPEPEGAEVPESAEAPGAEGRPALSGPVPW
LVSGRTEAALRAQAARLAEHLAGRPEATPLDVGFSLARTRSAFEQRAVVVSADRDELIAG
LRSVADSGDGAGVAGVVAGRATADSGVVFVFPGQGSQWVGMAAELLDSAPVFRARMEECG
EALAPHVDWSLLAVVRQEEGTPSWSRVDVVQPVLWAVMVSLAAVWRSFGVEPAAVVGHSQ
GEVAAACVAGGLSLEDGARVVAVRSRLVLEKLSGKGGMVSVALPVGEVEERLARFEGRIG
VAAVNGPGSVVVSGEPDALDELLAECEESGVRARRIAVDYASHSAQVDALNEDLLRELAD
IQPRSSSVAFYSTVTGERLDTSGLDARYWVTNLRERVRFEPVVRLLAEKGSSVFVESSPH
PVLTMAVAETGEVADRAVVTVGSLRRDDGGADRFLTSLAEAYVAGAPVDWSVLFAGMPVR
RVDLPTYAFQHQRYWLDDVALPGQSGFSDDPADAAFWGAVERADVQGVAALVDGAEPEVW
EPVLSALSAWRRGRQERSVLDSWRYRTVWRSVTVPSVGRLSGTWLVVTPGGAGPVEEVRR
ALEAVGAEAVVLAWEAEEGREALAGRLTGAGEVSGVVSLLGWDEEAAPVATVTLVQALAD
AGVEAPLWVLTQGAASVGAEDVVHPVQTQVWALGQVAGLEQPGSWGGLVDVPGVWDERVA
SGLTAVLAAGEGEDQVAVRSSGAYARRLVRAPLGANPAPVRDWNPHGTVLITGGTGGIGA
HLARWLAKEGAERLLLVSRSGEQAEGAAELATELGGLGAEVTFAACDVSDRDALAHVIAG
IPAEHPLTAVFHTAGISGYAELATATPEHFTDVLSARVLGARHLDELTAELGVELEAFVV
FSSGAAVWGSGSNGANAAAGGYLDGLVRRRRARGVAGTSVSWGGWQATAMAVGDTAEQLS
RRGVRLLDPVLAVQALRQVLEQDEVSVTVTDMDWALFTPGYAMARRRPLIEDIPEAGEAL
SGAAGAGETLDSAGVGLRERLAAMTETERQATLLGLVRGEAAQVLAHGSTAEITPTRPFK
ELGFDSLTAMDLRNRLSKATGLRLPATLVFDYPNPEQLAALLRTELVDGLPGTAGPAAPA
VRPVDDEPLAIVGMACRYPGGVRDADDLWRLIVEGRDELSDFPTDRGWDRWGAPAVGQAG
FLHEAGEFDAAFFGISPREAASMDPQQRLLLETSWEAVEQAGIDPWSLRGSSTGVFVGGG
PQDYPAVLMGSAEAGGGYGMTGALGSVMSGRVSYVLGLEGPAVTVDTACSSSLVALHLAA
QSLNNGECELALAGGVTIMATPGAFAEFDTLGGMAGDGRCKAFAASADGTGWGEGVGMVV
VERLSDARRNGHEVLAVIRGSAINQDGASNGLSAPNGPSQQRVIRQALANAGLSAADVDM
VEAHGTGTTLGDPIEAQALLATYGQDRPADRPLWLGSVKSNFGHTGAAAGVAGVIKAVLA
LRNGLLPKTLHVDEPTPQVDWSAGAVELLTQAREWPDAERPRRAGVSSFGISGTNAHVIL
EQAPEPEGAEVPGSAEAPGAEGRPALSGPVPWLVSGRTEAALRAQAARLAEHLAGRPEAA
PLDVGFSLATTRANLEHRAVVLGSTSEELTRGLNAVAEAAISPAVIRGNGTDTGVVFVFP
GQGSQWVGMGRDLWDVSPVFAESMVACERALSPLVDWSLRDVVFRDAGDPLWSRVDVVQP
VLWAVMVSLAAVWRSFGVEPAAVVGHSQGEVAAACVAGGLSLEDGARVVAVRSRLVLEKL
SGKGGMVSVALPVEGVEERLARFEGRIGVAAVNGPTSVVVSGEPEALDELLAECEGSGVR
ARRIAVDYASHSAQVDALNDDLLAELAGIRPKSSTVAFYSTVTGGRLDTSGLDARYWVTN
LRERVRFEPVVRLLADQAHGLFVEASPHPVLNMAVAETGEVADRAVVTVGSLRRDDGGAD
RLLTSLAEAHVAGAPVDWSVLFAGTGTRRIGLPTYAFQHQRYWLEDAAAPGTDGVVDPVD
AAFWGAVERADVQGVAALVDGADPEAWEPVLSALSAWRKGRQERSVLDSWRYRTVWRSVT
VPSAGRLSGTWLVVAPGEGAPAERIEEALVGAGAEVVVLAWETEEGREALAGRLAEAGEL
SGVVSLLGWDEKAAPAATVTLVQGLADAGVEAPLWVLTHGAASVGSGDVIRPVQTQVWAL
GQIVGLEQPGSWGGLVDVPEVWDERVASGFAGVLAAGEGEDQVAVRSSGAYARRLVRAPL
GANPAPVRDWNPHGTVLITGGTGGIGAHLARWLAKEGAERLLLVSRSGERAEGAAELAAE
LGGLGAEVTFAACDVTDRDALAHVIAEHPPTAVFHTAGVASYGTVRELDLADLDAQMAAK
TLGARHLDELTTERGLELDAFVVFSSGAAIWGSAGNGGYAAANAYLDGLAWDRRARGLAA
TSVSWGGWKATGMATDDTAEQLARRGVRPMDPARAVEALRQALEQDETALTVTDMDWERF
TPGYTMARRRPLIEDIPEVARVLSEDSADVLGDDSAGSALRTELAALGQAEQLDLLLDLV
RGEAARILAHSSTAEITPERPFKELGFDSLTAMELRNLLNTATGLRLPATLVFDYPNPRQ
LAAHLRTELIGAGPDLVPAADVVRADADEPLAIVGMACRYSGGVSSPEDLWQVVVENKDG
MSDFPSYRGWDRWNLASLRRAGFLHEAGDFDAGFFGISPREAMAMDPQQRLLLEASWEAV
ERTGIDPHSLRGSDTGVFVGGTAVEYGALLMNSPASQGYAVTGSSGSVMSGRISYTLGLE
GPAVTVDTACSSSLVALHLAAQALRGGECSLALTGGVGLMATPGAFAEFDTLGGLSVDGR
TKAFAAAADGIGWGEGVGMVVVERLSDARRNGHEVLAVIRGSAINQDGASNGLSAPNGPS
QQRVIRQAVANAGLALADVDMVEAHGTGTTLGDPIEAQALLATYGQERPADRPLWLGSVK
SNIGHTGAAAGVAGVIKSVLALRNGLLPKTLNVDEPTPKVDWSAGAVELLTQAREWPQGE
RPRRAGVSSFGISGTNAHVIIEEAPAAEETPAAPDEAAPAAPALVTPVVPWVFSGRSSGA
LCGQAGRLGGLVEREPGLDVTDVAFSLATTRANLEHRAVVLGGDAAGLLDRLRSVAAREP
DAGVVSGTTAAGGRVVFVFPGQGSQWVGMGRDLWDVSPVFAESMVACERALSPLVDWSLR
DVVFRDAGDPLWSRVDVVQPVLWAVMVSLAAVWRSFGVDPAAVVGHSQGEVAAACVAGGL
SLEDGARVVAVRSRLVLEKLSGKGGMVSVALPVEGVEERLARFEGRIGVAAVNGPTSVVV
SGEPDALDELLAECEESGVRARRIAVDYASHSAQVDALNDDLLAELADIRPKSSTVAFYS
TVTGDRLDTSGLDARYWVTNLRERVRFEPVVRLLAEKGSSVFVESSPHPVLTMAVAETGE
VADRAVVTVGSLRRDDGGADRLLTSLAEAYVAGAPVDWSVLFAGTGARRVDLPTYAFQHQ
RYWLEGVSVGGEIQEASADAMDAAFWDAVEREDLADLTEVLDTSGGTGPDPAAAAEAWLP
ALSAWRKGRRKQTTLDSWRYRTEWRTNDRPLSARLSGTWLVVAPSDGAPTERMERTLAGA
GAEVVVLAIEAGTDRAELAERLAGTPEAAGVVSLLAWDEHTAVASTLTLIQAHGDIESAA
PLWVVTRGAASVDSGDEIRPVQTQVWALGQIVGLEQPGSWGGLVDVPEVWDERVASQVAG
VLAAGEGEDQVAVRSSGAYARRLVRAPLGANPAPVRDWNPHGTVLITGGTGGIGAHLARW
LAKEGAERLLLVSRSGERAEGAAELAAELGGLGAEVTFAACDVTDRDALAHVIAGIPAEH
PLTAVFHTAGVAGHGPLADLDVTDLDTQTAARIAGARHLDELTAELGVELEAFVVFSSGA
AVWGSGSNGANAAAGGYLDGLVRLRRARGVAGTSVSWGGWQATAMAVGDTAEQLSRRGVR
LLDPVLAVQALRQALEQDEVSVTVTDMDWALFTPGYAMARRRPLIEDIPEAAQVLRDAEE
IEDGPEDGAAGADLRKRLAGLTDPERQATLLGLVRGEAAQVLAHGSTAEITPTRPFKELG
FDSLTAMDLRNRLSKATGLRLPATLVFDHPNPQRIAEHLRAGLAQDGQQGIADVLDIRRE
LTRIGEALNSVAPDARAREDIVDHLRDLITQLGTGTGAAEQDTTDLEAATDDEIFDFIDR
DLGVS
selected fasta
>polyketide synthase [modular polyketide synthase]
ATGAACAGTTCCATGTCGGAGGTCGTCGACGCGCTGCGGGCCTCGCTGCTGGAGAACGAG
CGGCTTCGGCAGCAGAACCAGCGGCTCACCACGGCCTCCGCGGAACCTCTCGCCATCGTG
GGCATCGGCTGCCGCTACCCGGGCGGTGTCCGCGACACCGAGGACCTGTGGCGGCTGATC
ACGGAAGGCCGCGACGCCATGTCGGGCTTCCCCACCGACCGCGGCTGGGACCGCTGGGAC
ATCCCCACCGCCCGTACGGGTGCCTTCCTCCACGACGCCGGCGACTTCGACCCCGCCTTC
TTCCGCATCTCGCCGCGTGAGGCGATGGCGATGGACCCGCAGCAGCGGCTGCTCCTGGAA
ACGTCGTGGGAGGCACTGGAGCGGGCCGGCATCGACCCCGCCACGCTCAAGGGAAGCCGC
ACCGGCGTGTTCATCGGCGGAGCCCCGCAGGAGTACGGCGCGCTGGTGATGAACTCGGCC
GAGGGAGCGGGCGGTTACGCGCTGACGGGCGCCCCCGGCAGTGTGCTGTCCGGCCGGATC
TCCTACGTGCTGGGCCTGGAGGGTCCCGCGGTCACGGTGGACACGGCGTGCTCGTCCTCG
CTGGTCGCCCTGCACCTCGCCGTCAAGTCGCTGCGCACCGGCGAATGCGATCTCGCGCTG
GCCGGCGGCGTGCTGGTGCTCGTCACCCCGTCGATCTTCGCGGAGTTCTCGGCGACCGGC
GGATCGGCGGGCGACGGCCGCTGCAAGGCCTTCGCCGCGTCCGCCGACGGCACCGGCTGG
GGCGAAGGGGCGGGCGTACTCGCCGTCCAGCGCCTGACCGACGCGCGCCGGGACGGTCAC
CCCGTCCTGGCGGTGATCCGCGGGTCGGCGGTGAACCAGGACGGCGCGTCGAACGGTCTG
AGCGCGCCGAACGGTCCTTCGCAGCAGCGGGTGATCCGGCAGGCGCTGGCGAACGCCGGT
CTGTCGGCCGCCGACGTGGACATGGTGGAGGCGCACGGCACGGGGACGACGCTGGGCGAC
CCGATCGAGGCCGAAGCGCTGCTCGCGACCTACGGCCAGGACCGCCCGGCCGACCGGCCG
CTGTGGCTCGGCACCCTGAAGTCCAACATCGGACACACCCAGGCCGCGGCCGGCGTCTCC
GGAGTGATCAAGGCCGTTCTCTCGCTCCAGCACGGCCTGTTGCCGAAGACGCTGCATGTG
GACGAGCCGACGCCGCAGGTGGACTGGTCGGCGGGTGCGGTGGAGCTGTTGACGCAGGCG
CGGGAGTGGCCGGAGACGGACGGCCCGCGACGGGCGGGTGTGTCCTCGTTCGGCATCAGT
GGCACGAACGCGCACGTGATCCTGGAACAGGCGCCGGAGCCGGAGGGCGCGGAGGTACCG
GAGTCCGCGGAGGCGCCGGGGGCGGAGGGGCGTCCGGCGTTGAGCGGGCCGGTGCCGTGG
CTGGTGTCGGGGCGTACCGAGGCGGCGTTGCGGGCTCAGGCGGCACGGCTGGCCGAGCAC
CTGGCCGGGCGTCCCGAGGCGACCCCGCTGGATGTGGGCTTCTCGCTGGCGCGGACCCGT
TCGGCCTTCGAACAGCGGGCGGTGGTGGTGAGCGCCGACCGCGACGAACTGATCGCCGGA
CTGCGGTCGGTCGCCGACAGCGGGGACGGTGCGGGCGTCGCGGGTGTCGTGGCCGGCCGA
GCCACCGCCGACAGCGGCGTCGTGTTCGTGTTCCCGGGTCAGGGGTCGCAGTGGGTGGGG
ATGGCGGCGGAGCTGCTGGACTCCGCACCGGTGTTCCGCGCACGGATGGAGGAGTGCGGG
GAGGCACTGGCCCCGCACGTCGACTGGTCGCTGCTCGCCGTGGTGCGGCAGGAGGAGGGC
ACTCCGTCCTGGTCCCGGGTGGATGTGGTGCAGCCGGTGTTGTGGGCGGTGATGGTGTCG
CTGGCGGCGGTGTGGCGTTCGTTCGGGGTGGAGCCTGCCGCTGTCGTGGGGCATTCGCAG
GGTGAGGTCGCTGCGGCGTGTGTGGCGGGTGGGCTGTCGCTGGAGGACGGGGCGCGGGTG
GTGGCCGTGAGGTCGCGGCTGGTGCTGGAGAAGCTGTCCGGCAAGGGCGGCATGGTGTCC
GTTGCGCTGCCGGTCGGGGAGGTCGAGGAGCGTCTCGCCCGGTTCGAGGGCCGGATCGGT
GTCGCGGCCGTCAACGGGCCCGGCTCCGTCGTCGTCTCCGGTGAGCCCGACGCACTGGAT
GAACTCCTTGCGGAATGTGAGGAGTCAGGGGTACGGGCCCGTCGTATCGCGGTGGATTAC
GCCTCGCACTCCGCGCAGGTGGATGCCCTCAACGAGGATCTGTTGAGGGAGCTCGCGGAC
ATTCAGCCCCGGTCGTCGTCGGTGGCGTTCTACTCGACGGTGACGGGTGAGCGGCTGGAC
ACGTCCGGTCTGGACGCGCGGTACTGGGTGACGAATCTGCGGGAGCGGGTGCGGTTCGAG
CCGGTGGTGCGGCTGTTGGCGGAGAAGGGGAGTTCGGTCTTCGTCGAGTCGAGTCCGCAT
CCGGTGTTGACGATGGCGGTGGCCGAGACCGGTGAGGTCGCGGACCGGGCTGTGGTGACA
GTGGGGTCGTTGCGGCGTGACGACGGTGGCGCGGACCGCTTCCTGACGTCGCTCGCGGAG
GCCTACGTGGCGGGCGCTCCCGTCGACTGGTCGGTGCTGTTCGCCGGGATGCCGGTGCGC
CGGGTCGATCTGCCGACCTACGCGTTCCAGCACCAGCGCTACTGGCTCGACGACGTTGCG
CTGCCCGGCCAGAGCGGTTTCTCCGACGACCCGGCGGATGCCGCGTTCTGGGGTGCGGTG
GAGCGCGCCGATGTGCAGGGCGTGGCCGCGCTGGTGGACGGTGCGGAGCCTGAGGTGTGG
GAGCCGGTGCTCTCGGCGTTGTCGGCTTGGCGCCGGGGGCGTCAGGAGCGGTCGGTGCTG
GATTCGTGGCGGTATCGGACGGTGTGGCGTTCGGTGACGGTGCCGTCGGTGGGCCGGTTG
TCGGGGACGTGGCTGGTGGTGACGCCGGGGGGCGCGGGGCCGGTCGAGGAGGTCCGGCGG
GCGCTGGAGGCGGTCGGCGCCGAGGCCGTCGTACTGGCGTGGGAGGCGGAGGAGGGCCGT
GAGGCTCTGGCCGGGCGCCTTACCGGAGCCGGTGAGGTGTCGGGTGTGGTGTCGCTGTTG
GGCTGGGATGAGGAGGCCGCGCCTGTCGCGACGGTGACGCTCGTCCAGGCTTTGGCGGAT
GCCGGGGTCGAGGCGCCGTTGTGGGTGTTGACGCAGGGTGCCGCGTCGGTGGGTGCGGAG
GATGTGGTGCACCCGGTGCAGACGCAGGTGTGGGCGCTGGGTCAGGTGGCCGGTCTGGAG
CAGCCGGGTAGTTGGGGTGGTCTGGTCGATGTGCCGGGGGTGTGGGACGAGCGGGTTGCT
TCCGGGCTGACTGCCGTGTTGGCGGCGGGGGAGGGTGAGGATCAGGTAGCGGTGCGGTCG
TCGGGTGCGTATGCCCGTCGTCTGGTGCGGGCTCCGCTGGGTGCGAACCCGGCACCCGTA
CGCGACTGGAACCCCCATGGCACGGTGCTGATCACGGGTGGTACCGGCGGTATTGGTGCG
CATCTGGCCCGTTGGCTGGCGAAGGAGGGCGCCGAGCGTCTGCTGCTGGTCAGCCGTAGT
GGCGAGCAGGCAGAAGGTGCTGCCGAACTGGCCACGGAGTTGGGCGGCTTGGGCGCGGAG
GTGACGTTCGCCGCGTGCGACGTGAGCGACCGCGACGCCCTCGCCCACGTGATCGCCGGC
ATCCCGGCGGAGCACCCCCTCACCGCCGTCTTCCACACCGCCGGTATATCCGGTTACGCG
GAACTCGCCACCGCCACCCCCGAGCACTTCACCGACGTGCTCTCCGCCCGCGTTCTCGGC
GCTCGTCATCTGGACGAGTTGACCGCCGAGCTCGGTGTGGAGTTGGAGGCGTTCGTGGTG
TTCTCCTCCGGGGCTGCGGTGTGGGGCAGTGGCAGTAATGGTGCGAATGCGGCCGCGGGC
GGTTATCTGGACGGTCTGGTGCGGCGGCGGCGGGCGCGTGGTGTGGCGGGGACGTCGGTG
TCGTGGGGCGGTTGGCAGGCGACGGCGATGGCGGTGGGGGACACGGCGGAGCAGTTGTCG
CGTCGGGGTGTGCGGCTGCTGGATCCGGTGCTGGCGGTGCAGGCGTTGCGGCAGGTGCTG
GAGCAGGACGAGGTGTCGGTGACGGTGACCGACATGGACTGGGCGCTGTTCACTCCGGGA
TACGCGATGGCCCGGCGCCGCCCGCTCATCGAGGACATCCCCGAAGCCGGTGAGGCACTG
AGTGGGGCGGCCGGGGCCGGGGAGACCCTGGACTCGGCAGGCGTGGGTCTGCGGGAGCGG
CTCGCCGCGATGACGGAGACCGAGCGGCAGGCCACGCTGCTGGGGCTGGTGCGCGGCGAG
GCGGCCCAGGTGCTGGCGCACGGGTCGACGGCGGAGATCACGCCGACCAGGCCGTTCAAG
GAACTCGGCTTCGACTCGCTGACCGCGATGGACCTGCGCAACCGGCTGTCCAAGGCCACC
GGACTGCGACTGCCGGCCACGCTCGTCTTCGACTATCCCAACCCGGAACAGCTGGCGGCC
CTGCTGCGTACCGAGCTGGTGGACGGTCTGCCGGGGACAGCCGGACCCGCGGCACCGGCC
GTCCGGCCGGTGGACGACGAACCGCTCGCGATCGTCGGCATGGCCTGCCGCTACCCCGGT
GGCGTGCGCGACGCCGACGACCTGTGGCGGCTGATCGTCGAAGGCCGCGACGAACTGTCC
GACTTCCCCACCGATCGCGGCTGGGACCGCTGGGGCGCACCCGCGGTCGGCCAGGCCGGT
TTCCTGCACGAGGCAGGGGAGTTCGACGCCGCCTTCTTCGGGATCTCGCCGCGTGAGGCG
GCGTCGATGGACCCGCAGCAGCGGCTGCTCCTCGAGACGTCGTGGGAGGCGGTGGAGCAG
GCCGGTATCGATCCGTGGTCGCTGCGAGGCAGCTCCACCGGAGTGTTCGTCGGCGGCGGC
CCGCAGGACTACCCCGCGGTGCTGATGGGCTCGGCCGAGGCCGGCGGCGGCTACGGCATG
ACCGGTGCGCTCGGCAGCGTGATGTCGGGCCGGGTGTCGTACGTGCTGGGCCTGGAGGGT
CCCGCGGTGACGGTGGACACGGCGTGCTCGTCCTCGCTGGTCGCCCTGCACCTAGCCGCT
CAGTCCCTGAACAACGGCGAGTGCGAGCTGGCCCTGGCCGGCGGTGTGACCATCATGGCC
ACGCCGGGCGCGTTCGCGGAGTTCGACACCTTGGGCGGTATGGCGGGCGACGGCCGCTGC
AAGGCCTTCGCGGCATCCGCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCATGGTGGTC
GTCGAGCGGCTCTCGGACGCGCGCCGCAACGGTCACGAAGTGCTCGCCGTCATCCGTGGC
AGCGCGATCAACCAGGACGGCGCGTCGAACGGTCTGAGCGCGCCGAACGGGCCTTCGCAG
CAGCGGGTGATCCGGCAGGCGCTGGCGAACGCCGGTCTGTCGGCCGCCGACGTGGACATG
GTGGAGGCGCACGGTACGGGGACGACGCTGGGCGACCCGATCGAGGCCCAGGCGCTGCTG
GCCACCTATGGGCAGGACCGTCCGGCCGACCGGCCGCTGTGGCTCGGCTCCGTGAAGTCC
AACTTCGGGCACACGGGTGCCGCGGCCGGCGTGGCGGGCGTCATCAAGGCCGTACTGGCC
CTGCGCAACGGCCTGTTGCCGAAGACGCTGCATGTGGACGAGCCGACGCCGCAGGTGGAC
TGGTCGGCGGGTGCGGTGGAGCTGTTGACGCAGGCGCGGGAGTGGCCGGATGCGGAGCGT
CCGCGCCGGGCGGGTGTGTCGTCGTTCGGGATCAGTGGCACGAACGCGCACGTGATTCTG
GAGCAGGCGCCGGAGCCGGAGGGTGCGGAGGTGCCGGGGTCCGCGGAGGCGCCGGGGGCG
GAGGGGCGTCCGGCGTTGAGCGGGCCGGTGCCGTGGCTGGTGTCGGGGCGTACCGAGGCG
GCGTTGCGGGCTCAGGCGGCACGGCTGGCCGAGCACCTGGCCGGGCGTCCCGAGGCGGCC
CCGCTGGATGTGGGCTTCTCGCTGGCGACGACGCGAGCGAACCTGGAACACCGTGCGGTG
GTACTCGGCAGCACCTCGGAGGAACTCACGCGCGGGCTGAACGCCGTCGCCGAAGCCGCC
ATCTCCCCGGCCGTGATCCGTGGCAACGGCACGGACACCGGTGTGGTGTTCGTGTTCCCG
GGTCAGGGGTCGCAGTGGGTGGGGATGGGGCGGGATTTGTGGGATGTCTCGCCGGTGTTC
GCCGAGTCGATGGTGGCGTGTGAGCGGGCGTTGTCGCCGTTGGTGGACTGGTCGTTGAGG
GATGTGGTGTTCCGGGACGCGGGGGATCCGTTGTGGTCTCGGGTGGATGTGGTGCAGCCG
GTGTTGTGGGCGGTGATGGTGTCGCTGGCGGCGGTGTGGCGTTCGTTCGGGGTGGAGCCG
GCTGCGGTGGTCGGGCATTCGCAGGGTGAGGTTGCTGCGGCGTGTGTGGCGGGTGGTCTG
TCGCTGGAGGACGGGGCGCGGGTGGTGGCCGTGCGGTCGCGGCTGGTGCTGGAGAAGCTG
TCCGGTAAGGGCGGGATGGTGTCCGTTGCGCTGCCGGTGGAGGGCGTCGAGGAGCGTCTC
GCCCGGTTCGAGGGCCGGATCGGTGTCGCGGCGGTGAACGGGCCCACCTCGGTGGTGGTC
TCGGGGGAGCCCGAGGCACTGGATGAGCTCCTTGCGGAGTGTGAGGGGTCGGGGGTGCGG
GCCCGTCGTATCGCGGTGGACTACGCCTCGCACTCCGCGCAGGTGGATGCCCTCAACGAC
GACCTGCTCGCCGAACTCGCCGGCATCCGGCCGAAGTCGTCCACGGTCGCCTTCTATTCC
ACGGTGACCGGGGGGCGGCTGGACACGTCCGGTCTGGACGCCCGGTACTGGGTGACGAAT
CTGCGGGAGCGGGTCCGGTTCGAGCCGGTGGTGCGGCTGCTCGCCGACCAGGCGCACGGA
CTCTTCGTGGAAGCCAGTCCGCACCCCGTACTCAACATGGCGGTGGCCGAGACCGGTGAG
GTCGCGGACCGGGCTGTGGTGACGGTGGGGTCGCTGCGCCGTGACGACGGTGGCGCGGAC
CGTCTCCTGACGTCACTCGCCGAGGCACACGTCGCCGGTGCTCCCGTCGACTGGTCGGTG
CTGTTCGCCGGCACCGGAACCCGCCGGATCGGGCTGCCGACGTACGCCTTCCAGCACCAG
CGCTACTGGCTCGAGGACGCGGCCGCGCCCGGTACGGACGGCGTCGTCGACCCGGTGGAC
GCGGCCTTCTGGGGTGCGGTGGAGCGCGCCGATGTGCAGGGCGTGGCCGCGCTGGTCGAC
GGTGCGGACCCGGAGGCGTGGGAGCCGGTGCTCTCGGCGTTGTCGGCTTGGCGCAAGGGG
CGTCAGGAGCGGTCGGTGCTGGATTCGTGGCGGTACCGGACGGTGTGGCGTTCGGTGACG
GTGCCGTCGGCGGGCCGGCTGTCGGGCACGTGGCTGGTGGTCGCCCCCGGCGAAGGTGCT
CCGGCCGAGCGGATCGAGGAGGCCCTGGTCGGCGCCGGCGCCGAGGTCGTCGTACTGGCG
TGGGAGACGGAGGAGGGCCGCGAGGCGCTGGCCGGGCGCCTGGCCGAAGCCGGTGAACTG
TCCGGTGTGGTGTCGCTGCTGGGCTGGGACGAGAAGGCCGCACCCGCCGCGACAGTGACG
TTGGTTCAGGGCTTGGCGGATGCCGGGGTTGAGGCGCCGTTGTGGGTCCTGACGCATGGC
GCCGCCTCGGTGGGGTCGGGCGATGTGATCCGTCCGGTGCAGACGCAGGTGTGGGCGCTG
GGGCAGATCGTCGGTCTGGAGCAGCCGGGTAGTTGGGGCGGTCTGGTCGATGTGCCGGAG
GTGTGGGACGAGCGGGTTGCTTCCGGGTTCGCTGGTGTGTTGGCGGCGGGGGAGGGTGAG
GATCAGGTAGCGGTGCGGTCGTCGGGTGCGTATGCCCGTCGTCTGGTGCGGGCTCCGCTG
GGCGCGAACCCGGCACCCGTACGCGACTGGAACCCTCATGGCACGGTGCTGATCACCGGC
GGCACCGGTGGCATCGGTGCGCATCTGGCGCGCTGGCTGGCGAAGGAGGGCGCCGAGCGT
CTGCTGCTCGTCAGCCGTAGTGGTGAGCGGGCCGAGGGTGCTGCCGAACTGGCCGCGGAA
CTGGGCGGCTTGGGCGCGGAGGTGACGTTCGCCGCGTGCGACGTGACCGACCGCGACGCC
CTCGCCCACGTGATCGCCGAGCACCCGCCCACCGCCGTCTTCCACACCGCCGGAGTCGCC
AGCTACGGCACCGTACGGGAACTCGACCTCGCCGACCTGGACGCACAGATGGCCGCCAAG
ACCCTCGGCGCCCGTCACCTGGACGAGCTCACCACCGAACGCGGCCTCGAACTGGACGCC
TTCGTGGTGTTCTCCTCCGGAGCCGCGATCTGGGGCAGCGCCGGCAACGGCGGCTACGCC
GCGGCCAACGCGTACCTGGACGGACTCGCATGGGACCGCCGGGCCCGCGGCCTCGCCGCG
ACCTCCGTGTCGTGGGGCGGCTGGAAGGCCACCGGCATGGCCACCGACGACACCGCCGAG
CAGCTCGCGCGCCGCGGCGTCCGTCCGATGGACCCGGCACGGGCCGTCGAGGCCCTGCGA
CAGGCGCTGGAGCAGGACGAGACCGCGCTGACGGTCACCGACATGGACTGGGAACGCTTC
ACCCCCGGCTACACGATGGCCCGGCGCCGTCCCCTGATCGAGGACATCCCCGAAGTCGCC
CGCGTCCTGAGCGAGGACTCCGCCGACGTGCTCGGTGACGACTCGGCGGGCTCGGCCCTC
CGGACGGAGCTCGCGGCGCTCGGCCAGGCCGAGCAGCTCGATCTGCTGCTGGACCTGGTG
CGCGGCGAGGCGGCCCGCATCCTGGCCCACTCCTCCACGGCCGAGATCACTCCGGAGCGG
CCGTTCAAGGAACTCGGGTTCGACTCGCTGACCGCGATGGAACTGCGCAACCTGCTGAAC
ACCGCCACCGGTCTGCGGCTGCCCGCGACCCTCGTCTTCGACTACCCCAACCCGCGGCAG
CTCGCCGCCCACCTGCGCACCGAACTGATCGGCGCCGGGCCGGACCTCGTCCCGGCCGCC
GACGTCGTACGGGCCGATGCCGACGAACCCCTCGCCATCGTTGGCATGGCCTGCCGCTAC
TCGGGCGGAGTCTCCTCGCCGGAGGACCTGTGGCAGGTCGTGGTGGAGAACAAGGACGGG
ATGTCCGACTTCCCCTCCTACCGCGGCTGGGACCGGTGGAACCTCGCCAGCCTCCGCCGT
GCCGGATTTCTGCACGAGGCGGGCGACTTCGACGCCGGCTTCTTCGGGATCTCGCCGCGT
GAGGCGATGGCGATGGACCCGCAGCAGCGGCTGCTCCTCGAAGCGTCGTGGGAGGCCGTG
GAGCGCACCGGCATCGATCCGCACTCACTGCGGGGCAGCGACACCGGCGTCTTCGTCGGC
GGTACGGCCGTCGAGTACGGCGCGCTCCTGATGAACTCGCCGGCCAGCCAGGGCTACGCC
GTCACCGGTTCCTCCGGCAGCGTCATGTCCGGGCGCATCTCCTACACCCTCGGCCTGGAG
GGGCCCGCGGTGACGGTGGACACGGCGTGCTCGTCCTCGCTGGTCGCCCTGCACCTCGCC
GCCCAGGCGCTGCGCGGCGGTGAGTGCTCGCTCGCCCTGACCGGCGGCGTCGGTCTGATG
GCCACCCCGGGCGCGTTCGCGGAGTTCGACACGCTGGGCGGACTCTCGGTGGACGGCCGC
ACCAAGGCCTTCGCGGCCGCCGCCGACGGCATCGGCTGGGGCGAGGGCGTCGGCATGGTG
GTCGTCGAGCGGCTCTCGGACGCGCGCCGCAACGGTCATGAAGTGCTCGCCGTCATCCGT
GGCAGCGCGATCAACCAGGACGGTGCGTCGAACGGTCTGAGCGCGCCGAACGGTCCCTCG
CAGCAGCGGGTGATCCGGCAGGCGGTCGCCAACGCCGGACTGGCGCTGGCGGACGTGGAC
ATGGTGGAGGCGCACGGTACGGGGACGACGCTGGGCGACCCGATCGAGGCCCAGGCGCTG
CTGGCCACGTACGGTCAGGAGCGACCGGCCGACCGGCCGCTGTGGCTCGGCTCCGTGAAG
TCCAACATCGGGCACACGGGTGCCGCGGCCGGTGTCGCGGGCGTCATCAAGTCCGTACTG
GCCCTGCGCAACGGCCTGTTGCCCAAGACCCTGAACGTGGACGAACCGACCCCCAAGGTG
GACTGGTCCGCCGGTGCGGTGGAGCTGCTGACCCAGGCGCGGGAGTGGCCGCAGGGGGAG
CGTCCGCGCCGGGCGGGCGTGTCCTCGTTCGGCATCAGCGGCACGAACGCCCACGTGATC
ATCGAGGAGGCGCCCGCCGCCGAGGAGACACCGGCCGCGCCCGACGAGGCGGCCCCGGCA
GCACCCGCACTGGTGACGCCGGTCGTCCCGTGGGTGTTCTCGGGCCGGTCGAGCGGCGCC
CTGTGCGGCCAGGCCGGGCGCCTGGGCGGCCTGGTGGAGCGCGAGCCGGGCCTCGACGTC
ACCGACGTGGCGTTCTCGCTGGCGACGACGCGAGCGAACCTGGAACACCGTGCGGTGGTG
CTCGGCGGCGACGCGGCCGGCCTGCTCGACCGTTTGCGCTCGGTCGCCGCGCGGGAGCCG
GACGCCGGCGTCGTGTCGGGCACCACCGCCGCCGGTGGCCGGGTGGTGTTCGTGTTCCCG
GGGCAGGGGTCGCAGTGGGTGGGGATGGGGCGGGATTTGTGGGATGTCTCGCCGGTGTTC
GCCGAGTCGATGGTGGCGTGTGAGCGGGCGTTGTCGCCGTTGGTGGACTGGTCGCTGAGG
GATGTGGTGTTCCGGGACGCGGGGGATCCGTTGTGGTCCCGGGTGGATGTGGTGCAGCCG
GTGTTGTGGGCGGTGATGGTGTCGCTGGCGGCGGTGTGGCGTTCGTTCGGGGTGGACCCG
GCTGCGGTGGTCGGGCATTCGCAGGGTGAGGTCGCTGCGGCGTGCGTGGCCGGTGGTCTG
TCGCTGGAGGACGGGGCGCGGGTGGTGGCGGTGCGGTCGCGGCTGGTGCTGGAGAAGCTG
TCCGGCAAGGGCGGGATGGTGTCCGTTGCGCTGCCGGTGGAGGGCGTCGAGGAGCGTCTC
GCCCGGTTCGAGGGCCGGATCGGTGTCGCGGCGGTGAACGGGCCCACCTCGGTGGTGGTC
TCGGGGGAGCCCGACGCCCTCGACGAACTCCTCGCGGAGTGTGAGGAGTCGGGGGTGCGG
GCCCGTCGTATCGCGGTGGACTACGCCTCCCACTCCGCGCAGGTCGACGCCCTCAACGAC
GACCTGCTCGCCGAACTCGCCGACATCCGGCCCAAGTCGTCCACGGTCGCCTTCTACTCC
ACGGTGACCGGCGACCGGCTGGACACGTCCGGTCTGGACGCGCGGTACTGGGTGACGAAT
CTGCGGGAGCGGGTGCGGTTCGAGCCGGTGGTGCGGCTGTTGGCGGAGAAGGGGAGTTCG
GTCTTCGTCGAGTCGAGTCCGCATCCGGTGTTGACGATGGCGGTGGCCGAGACCGGTGAG
GTCGCGGACCGGGCTGTGGTGACGGTGGGGTCGTTGCGGCGTGACGACGGTGGCGCGGAC
CGTCTCCTGACCTCGCTCGCCGAGGCCTACGTGGCGGGCGCGCCCGTCGACTGGTCGGTG
CTGTTCGCCGGCACCGGGGCCCGCCGGGTCGACCTGCCGACCTACGCCTTCCAGCACCAG
CGCTACTGGCTCGAAGGCGTCTCCGTCGGAGGCGAGATCCAGGAGGCCTCGGCGGACGCG
ATGGACGCCGCGTTCTGGGATGCCGTGGAACGTGAGGATCTCGCCGATCTCACCGAGGTG
CTCGACACATCCGGCGGCACCGGGCCCGACCCGGCCGCCGCCGCGGAGGCCTGGCTGCCC
GCGCTGTCGGCCTGGCGCAAGGGCCGCCGGAAGCAGACGACACTCGACTCGTGGCGCTAC
CGCACCGAATGGCGCACGAACGATCGGCCCCTCTCGGCACGGCTGTCGGGCACGTGGCTG
GTGGTCGCCCCGAGCGACGGTGCGCCGACCGAGCGGATGGAGCGGACCCTCGCCGGCGCC
GGTGCCGAGGTCGTGGTCCTGGCGATCGAGGCGGGGACGGACCGGGCGGAGCTGGCCGAA
CGGCTCGCCGGGACTCCCGAGGCGGCGGGCGTGGTCTCGCTGCTCGCCTGGGACGAACAC
ACCGCGGTCGCCTCGACACTGACGCTCATCCAGGCCCATGGCGACATCGAGTCGGCGGCC
CCTCTGTGGGTGGTGACCCGCGGAGCCGCGTCCGTGGACTCGGGCGATGAGATCCGTCCG
GTGCAGACGCAGGTGTGGGCGCTGGGGCAGATCGTCGGTCTGGAGCAGCCGGGCAGTTGG
GGTGGTCTGGTCGATGTGCCGGAGGTGTGGGACGAGCGGGTGGCCTCTCAGGTTGCTGGT
GTGTTGGCGGCGGGGGAGGGTGAGGATCAGGTAGCGGTGCGGTCGTCGGGTGCGTATGCG
CGGCGTCTGGTGCGGGCTCCGCTGGGTGCGAATCCGGCACCCGTACGCGACTGGAACCCC
CATGGCACGGTGCTGATCACCGGCGGCACCGGTGGCATCGGTGCGCATCTGGCGCGCTGG
CTGGCGAAGGAGGGCGCCGAGCGTCTGCTGCTCGTCAGCCGTAGTGGTGAGCGGGCCGAG
GGTGCTGCCGAACTGGCCGCGGAACTGGGCGGGTTGGGTGCGGAGGTGACGTTCGCCGCG
TGCGACGTGACCGACCGCGACGCCCTCGCCCACGTGATCGCCGGCATCCCGGCGGAGCAC
CCCCTCACCGCCGTCTTCCACACCGCCGGAGTCGCCGGTCACGGACCGCTGGCCGACCTC
GACGTGACCGACCTCGACACGCAGACCGCCGCCAGGATCGCGGGCGCTCGTCATCTGGAC
GAGTTGACCGCCGAGCTCGGTGTGGAGTTGGAGGCGTTCGTGGTGTTCTCCTCCGGGGCT
GCGGTGTGGGGCAGTGGCAGTAATGGTGCGAATGCGGCCGCGGGCGGTTATCTGGACGGT
CTGGTGCGGTTGCGGCGGGCGCGTGGTGTGGCGGGGACGTCGGTGTCGTGGGGCGGTTGG
CAGGCGACGGCGATGGCGGTGGGGGACACGGCGGAGCAGTTGTCGCGTCGGGGTGTGCGG
CTGCTGGATCCGGTGCTGGCGGTGCAGGCGTTGCGGCAGGCGCTGGAGCAGGACGAGGTG
TCGGTGACGGTGACCGACATGGACTGGGCGCTGTTCACTCCGGGATACGCGATGGCCCGG
CGCCGCCCGCTCATCGAGGACATCCCCGAGGCGGCACAGGTACTGCGTGACGCCGAGGAG
ATCGAGGACGGCCCGGAGGACGGGGCGGCCGGCGCGGATCTGCGCAAGCGTCTGGCCGGG
CTGACCGACCCCGAGCGGCAGGCCACGCTGCTGGGGCTGGTGCGCGGCGAGGCGGCCCAG
GTGCTGGCGCACGGGTCGACGGCGGAGATCACGCCGACCAGGCCGTTCAAGGAACTCGGC
TTCGACTCGCTGACCGCGATGGACCTGCGCAACCGGCTGTCCAAGGCCACCGGACTGCGG
CTGCCGGCCACGCTCGTCTTCGACCACCCCAACCCGCAGCGCATCGCCGAACACCTCCGC
GCCGGGCTGGCCCAGGACGGGCAGCAGGGCATCGCCGACGTCCTCGACATCCGGCGTGAG
CTGACCCGGATCGGCGAGGCGCTGAACAGCGTCGCACCCGATGCCCGGGCCCGCGAGGAC
ATCGTCGACCATCTCCGCGACCTCATCACCCAGCTCGGCACCGGCACCGGAGCCGCCGAG
CAGGACACCACCGATCTCGAAGCCGCGACGGACGACGAGATCTTCGACTTCATCGACCGC
GACCTAGGCGTGTCCTGA
[12] KS35..401
[12] AT568..887
[12] methylmalonyl-CoA760..764
[12] kr1187..1368
[12] ACP1473..1543
[13] KS1567..1933
[13] AT2096..2415
[13] methylmalonyl-CoA2288..2292
[13] KR2714..2891
[13] ACP2996..3066
[14] KS3089..3454
[14] AT3616..3935
[14] methylmalonyl-CoA3808..3812
[14] kr4242..4423
[14] ACP4530..4600
[12] KS103..1203
[12] AT1702..2661
[12] methylmalonyl-CoA2278..2292
[12] kr3559..4104
[12] ACP4417..4629
[13] KS4699..5799
[13] AT6286..7245
[13] methylmalonyl-CoA6862..6876
[13] KR8140..8673
[13] ACP8986..9198
[14] KS9265..10362
[14] AT10846..11805
[14] methylmalonyl-CoA11422..11436
[14] kr12724..13269
[14] ACP13588..13800

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [561-691]  G3DSA:3.40.366.10 [760-877]  G3DSA:3.40.366.10 [2091-2219]  G3DSA:3.40.366.10 [2288-2405]  G3DSA:3.40.366.10 [3609-3739]  G3DSA:3.40.366.10 [3808-3925]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1187-1354]  1.29999999999998e-52 PF00106 [2714-2878]  8.70000000000003e-54 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1501-1516]  PS00012 [3024-3039]  PS00012 [4558-4573]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1472-1546]  8.19999999999987e-66 G3DSA:1.10.1200.10 [2996-3069]  8.19999999999987e-66 G3DSA:1.10.1200.10 [4529-4603]  8.19999999999987e-66 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1466-1583]  5.79999653854781e-28 SSF47336 [2989-3105]  5.8999880940569e-27 SSF47336 [4521-4607]  9.80000272130218e-22 SSF47336
SSF47336   ACP_like
 [1473-1543]  PS50075 [2996-3066]  PS50075 [4530-4600]  PS50075
PS50075   ACP_DOMAIN
 [1477-1542]  5e-13 PF00550 [2999-3065]  4.00000000000001e-13 PF00550 [4534-4599]  2e-13 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [4242-4422]  8.70000000000003e-52 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-275]  1.69999999999998e-87 PF00109 [1567-1807]  1.9e-85 PF00109 [3089-3328]  1.79999999999997e-83 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [283-401]  5.89999999999994e-47 PF02801 [1815-1933]  3.99999999999998e-47 PF02801 [3336-3454]  2.1e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [568-887]  2.99999999999998e-108 PF00698 [2096-2415]  9.3000000000001e-106 PF00698 [3616-3935]  6.10000000000004e-106 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-879]  6.20001486442668e-64 SSF52151 [2094-2407]  6.99997659850661e-63 SSF52151 [3614-3927]  1.10000150671643e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-759]  2.800005042611e-20 SSF55048 [2222-2287]  2.10000267834031e-19 SSF55048 [3742-3807]  9.39998942703831e-20 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [35-286]  G3DSA:3.40.47.10 [287-454]  G3DSA:3.40.47.10 [1570-1819]  G3DSA:3.40.47.10 [1820-1986]  G3DSA:3.40.47.10 [3092-3340]  G3DSA:3.40.47.10 [3341-3506]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-453]  3.79997359309398e-98 SSF53901 [1559-1985]  6.19996040581186e-99 SSF53901 [3081-3450]  5.79999653854781e-95 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1186-1407]  3.60000000000002e-98 G3DSA:3.40.50.720 [2714-2928]  6.29999999999998e-95 G3DSA:3.40.50.720 [4241-4459]  3.60000000000002e-98 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [188-204]  PS00606 [1720-1736]  PS00606 [3241-3257]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-868]  1.39999277195148e-118 SM00827 [2098-2396]  4.30000170645869e-117 SM00827 [3618-3916]  6.59996953923913e-118 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1474-1546]  5.40001756046195e-33 SM00823 [2997-3069]  2.9000035467798e-34 SM00823 [4531-4603]  3.70001063537244e-33 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-453]  SM00825 [1569-1985]  SM00825 [3091-3506]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1187-1368]  1.3000049540733e-38 SM00822 [2714-2891]  6.89998448199219e-48 SM00822 [4242-4423]  1.49999648196323e-39 SM00822
SM00822   PKS_KR
SignalP
 [1-34]  0.174 Signal
Bacteria, Gram-positive   
TMHMM No significant hit