close all open/close all

CDS information : Oligo_00130


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction83,059 / 81,845 / - [in whole cluster]
83,059 / 81,845 / - [in contig]
Locationcomplement(81845..83059) [in whole cluster]
complement(81845..83059) [in contig]
TypeCDS
Length1,215 bp (404 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)olmB
EC number
Keyword
  • C-12 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
[25849761] Functional characterization of CYP107W1 from Streptomyces avermitilis and biosynthesis of macrolide oligomycin A. (Arch Biochem Biophys. , 2015)
[26883908] Structural Analysis of the Streptomyces avermitilis CYP107W1-Oligomycin A Complex and Role of the Tryptophan 178 Residue. (Mol Cells. , 2016)
Related Reference
ACC
Q59523
PmId
[7808395] Characterization and expression of a P-450-like mycinamicin biosynthesis gene using a novel Micromonospora-Escherichia coli shuttle cosmid vector. (Mol Gen Genet. , 1994)
ACC
Q54302
NITE
Rapam_00170
PmId
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P450]
MAEAPSEPIAFPFPDPPSVCELPPELAEIRDGQSVVEVKFPDGISGWMVTKHADVRKVLV
DSRFSSKVMATAAAAMSETETGKLMNESLVGMDAPEHTRLRKLVTKAFTARRVETLRPRI
TELVGQLLDELETLPRPVDLVKNFSVPLPVRVICELLGVPAGDQDTFHAWSNALLGDWQQ
VVEKEAATVSLVNYFGELIAVKRENPADDLISELIAISDGDSTLTEREIIALSIGILSAG
HETTANQISMFLVTLLHNPEELDKLRDNREAIPKAVDELLRFVPLTTTGGIIPRLTTAEV
ELSGGQVLPAGAVVLPAVATANRDPEVFEDGERLNVTRENNPHLAFGAGIHHCLGAQLAR
IELQEALGAILDRMPQVRLAVPESELRLKSASIIRGLESLPITW
selected fasta
>cytochrome P450 [cytochrome P450]
ATGGCCGAAGCGCCTTCCGAGCCCATCGCGTTCCCGTTCCCCGACCCGCCGTCGGTCTGC
GAGCTGCCTCCCGAGCTGGCGGAGATCCGCGACGGCCAGTCCGTGGTGGAGGTGAAGTTC
CCCGACGGCATCAGCGGATGGATGGTGACCAAGCACGCCGATGTCCGCAAGGTGCTGGTC
GACTCCCGGTTCAGCAGCAAGGTGATGGCCACCGCGGCCGCCGCGATGTCGGAGACCGAG
ACCGGCAAGCTGATGAACGAGTCGCTCGTCGGCATGGACGCGCCGGAGCACACGCGGCTG
CGCAAGCTGGTGACCAAGGCGTTCACCGCGAGGCGGGTGGAGACGCTGCGGCCCCGCATC
ACGGAGTTGGTCGGCCAGCTGCTCGACGAGCTGGAGACGCTGCCCCGCCCGGTGGACCTG
GTCAAGAACTTCTCCGTGCCGCTGCCGGTCCGGGTGATCTGCGAACTCCTCGGCGTACCG
GCCGGGGACCAGGACACCTTCCACGCCTGGTCGAACGCGCTGCTCGGGGACTGGCAGCAG
GTGGTGGAGAAGGAGGCCGCGACGGTCTCGTTGGTGAACTACTTCGGCGAACTCATCGCG
GTGAAGCGGGAGAATCCCGCCGACGACCTGATCAGTGAGCTGATCGCGATCAGCGACGGG
GACAGCACGCTCACCGAGCGCGAGATCATCGCGCTGAGCATCGGCATTCTCAGCGCGGGC
CACGAGACGACCGCCAACCAGATCAGCATGTTCCTGGTGACGCTGCTGCACAATCCCGAG
GAGCTCGACAAGCTGCGGGACAACCGCGAGGCGATCCCGAAGGCCGTCGACGAGCTGCTC
CGCTTCGTTCCGCTCACCACGACCGGCGGCATCATTCCCCGGCTCACCACGGCGGAGGTG
GAGCTGAGCGGCGGCCAGGTGCTGCCCGCCGGCGCGGTGGTCCTGCCCGCGGTCGCCACC
GCGAACCGGGACCCCGAGGTGTTCGAGGACGGCGAGCGGCTGAACGTGACGCGGGAGAAC
AATCCGCATCTGGCCTTCGGCGCCGGTATCCACCACTGCCTCGGGGCGCAGCTCGCCCGC
ATCGAGCTCCAGGAGGCGCTCGGCGCGATCCTGGACCGGATGCCCCAGGTGCGGCTCGCG
GTGCCGGAGTCGGAGCTGCGGCTCAAGTCCGCGTCGATCATCCGCGGCCTCGAGAGCCTG
CCCATCACCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [239-256]  7.70000171387738e-09 PR00385 [274-285]  7.70000171387738e-09 PR00385 [344-353]  7.70000171387738e-09 PR00385 [353-364]  7.70000171387738e-09 PR00385
PR00385   P450
 [5-404]  3.89999861795218e-98 SSF48264
SSF48264   Cytochrome_P450
 [204-373]  5.59999999999999e-24 PF00067
PF00067   p450
 [15-404]  4.2e-108 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [92-103]  1.10000150671643e-45 PR00359 [139-155]  1.10000150671643e-45 PR00359 [156-171]  1.10000150671643e-45 PR00359 [193-215]  1.10000150671643e-45 PR00359 [274-285]  1.10000150671643e-45 PR00359 [323-338]  1.10000150671643e-45 PR00359 [344-353]  1.10000150671643e-45 PR00359 [353-364]  1.10000150671643e-45 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [346-355]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit