close all open/close all

CDS information : Oligo_00160


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction101,284 / 101,787 / + [in whole cluster]
101,284 / 101,787 / + [in contig]
Location101284..101787 [in whole cluster]
101284..101787 [in contig]
TypeCDS
Length504 bp (167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSVSEKEAETSAEQEFTRPPAPEKMRDLDFLLGDFRAEWTNFTADPATTGTAAWNTASTF
HGHAYEMTQRVEAHDLTGRFVVQWVESESSFSGYYYDDWGNRTLLTSEGWQDGYLAFTGE
CFGFGKSFLLKEQYEIVDEKHYVKRGFIKFDEGDWIPADEVHCHREA
selected fasta
>hypothetical protein [hypothetical protein]
ATGAGCGTTTCTGAGAAGGAAGCCGAAACTTCGGCCGAGCAGGAATTCACCAGGCCGCCG
GCCCCGGAGAAGATGCGGGATCTGGATTTCCTGCTCGGTGATTTCCGTGCGGAGTGGACC
AACTTCACCGCCGACCCGGCCACGACCGGCACGGCCGCCTGGAACACCGCGTCCACCTTC
CACGGGCACGCCTACGAGATGACGCAGCGGGTCGAGGCGCACGACCTCACCGGCCGCTTC
GTCGTCCAGTGGGTCGAGTCGGAATCGTCGTTCTCCGGCTACTACTACGACGACTGGGGA
AACCGCACCCTGCTGACCTCCGAGGGCTGGCAGGACGGTTATCTCGCGTTCACCGGAGAA
TGCTTCGGATTCGGCAAGTCCTTCCTGCTCAAGGAGCAGTACGAAATCGTCGACGAGAAG
CACTACGTCAAACGCGGTTTCATCAAGTTCGACGAAGGCGACTGGATCCCCGCGGACGAG
GTGCACTGCCACCGCGAGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit