close all open/close all

CDS information : Oligo_00170


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction101,928 / 103,280 / + [in whole cluster]
101,928 / 103,280 / + [in contig]
Location101928..103280 [in whole cluster]
101928..103280 [in contig]
TypeCDS
Length1,353 bp (450 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative crotonyl-CoA reductase
Product (GenBank)crotonyl-CoA reductase
Gene
Gene (GenBank)ccrA
EC number1.3.1.-
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Related Reference
ACC
Q53865
PmId
[8521864] Purification of crotonyl-CoA reductase from Streptomyces collinus and cloning, sequencing and expression of the corresponding gene in Escherichia coli. (Eur J Biochem. , 1995)
ACC
B8XVS5
PmId
[17548827] Synthesis of C5-dicarboxylic acids from C2-units involving crotonyl-CoA carboxylase/reductase: the ethylmalonyl-CoA pathway. (Proc Natl Acad Sci U S A. , 2007)
[19458256] Carboxylation mechanism and stereochemistry of crotonyl-CoA carboxylase/reductase, a carboxylating enoyl-thioester reductase. (Proc Natl Acad Sci U S A. , 2009)

close this sectionSequence

selected fasta
>putative crotonyl-CoA reductase [crotonyl-CoA reductase]
MTLLTEAVRAGAPPQELERAPLPGEYTAAYIQAEDARMFDGVADKDIRKSLRVGQVPMPE
LAPDEVLVAVMASAVNYNTVWSAMFEPVSTFRFLRQFATQGGWARRHDLPYHVIGSDGAG
VIVRVGSGVRRWGIGDHVVMSCVQPDDQEPATQADGMLGAEQRIWGFETNFGGLAHYAVV
RASQLIPKPAHLSWEEAACNPLCAGTAYRMLVGDRGARFKQGDVVLIWGAAGGLGAYAVQ
LVKNGGGIPVGVVSSPAKAEAARRLGCDVVIDRQDIGLDDRTADDPRAVIEVGKRLGTAI
RKRVGEDPHIVFEHVGRATFAVSVFVVRRGGTVVTCGSSTGYQHGYDNRYLWMKLKRIIG
SHAANLQEQWECNRLVSLGRIVPTLSAVYPLEEIGEAARSVQTNQHIGKVGVLCLASGPG
QGVTDPERRADLGEERLNPLRGLTPTRQAG
selected fasta
>putative crotonyl-CoA reductase [crotonyl-CoA reductase]
ATGACCCTGCTGACCGAAGCGGTACGTGCGGGCGCGCCGCCGCAGGAGCTGGAGCGCGCG
CCGCTGCCCGGGGAGTACACCGCCGCGTACATCCAGGCCGAGGACGCCCGGATGTTCGAC
GGAGTCGCCGACAAGGACATCCGCAAGTCGTTGCGCGTCGGCCAGGTCCCGATGCCCGAA
CTGGCGCCGGACGAGGTGCTGGTCGCGGTCATGGCCAGCGCGGTCAACTACAACACCGTG
TGGTCGGCGATGTTCGAGCCGGTCTCCACGTTCCGCTTCCTGCGGCAGTTCGCGACGCAG
GGCGGTTGGGCCCGACGCCACGATCTGCCGTACCACGTGATCGGTTCCGACGGGGCGGGC
GTGATCGTGCGCGTGGGCTCCGGCGTACGGCGCTGGGGCATCGGCGACCACGTGGTGATG
AGCTGCGTCCAGCCCGACGACCAGGAACCGGCCACGCAGGCCGACGGGATGCTCGGCGCC
GAGCAGCGGATCTGGGGCTTCGAGACCAACTTCGGCGGCCTGGCCCACTACGCGGTCGTC
AGGGCAAGCCAGTTGATCCCCAAGCCGGCCCACCTCAGCTGGGAGGAGGCGGCCTGCAAC
CCCCTGTGCGCGGGAACCGCGTACCGGATGCTCGTCGGCGACCGGGGCGCCCGCTTCAAG
CAGGGCGACGTCGTACTGATCTGGGGCGCCGCCGGCGGACTCGGCGCGTACGCGGTGCAG
CTCGTCAAGAACGGCGGCGGCATCCCGGTCGGCGTGGTCAGCTCGCCCGCCAAGGCGGAG
GCGGCCCGCAGACTCGGCTGCGACGTGGTCATCGACCGCCAGGACATCGGCCTCGACGAC
CGCACGGCCGACGACCCCCGTGCGGTGATCGAGGTGGGCAAGCGGCTCGGGACCGCCATC
CGCAAACGGGTGGGGGAGGACCCGCACATCGTCTTCGAGCACGTGGGCCGTGCCACCTTC
GCGGTCTCGGTCTTCGTGGTCCGGCGCGGCGGCACGGTGGTGACCTGCGGCTCCAGCACC
GGCTACCAGCACGGCTACGACAACCGCTACCTGTGGATGAAACTCAAGCGAATCATCGGC
AGCCACGCGGCGAACCTCCAGGAACAATGGGAGTGCAACCGCCTCGTCTCCCTCGGCCGC
ATCGTGCCGACGCTGTCCGCGGTCTATCCCCTGGAGGAGATCGGCGAGGCCGCCCGGTCG
GTCCAGACGAACCAGCACATCGGCAAGGTCGGAGTCCTGTGCCTGGCATCGGGCCCCGGC
CAGGGCGTGACGGACCCCGAACGCCGTGCCGACCTGGGCGAGGAACGCCTCAACCCGCTG
CGCGGACTCACACCGACGCGACAGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [222-243]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR010085 Crotonyl-CoA reductase (Family)
 [30-425]  TIGR01751
TIGR01751   Crot-CoA-red
IPR011032 GroES-like (Domain)
 [51-226]  2.30000440726534e-30 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [233-376]  4.00000000000001e-31 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [65-187]  9.60000000000001e-09 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [229-361]  3.2e-19 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit