close all open/close all
Oligo_00170 Oligo_00170   last last

CDS information : Oligo_00180


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction103,501 / 104,319 / + [in whole cluster]
103,501 / 104,319 / + [in contig]
Location103501..104319 [in whole cluster]
103501..104319 [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3-hydroxyacyl-CoA dehydrogenase
putative beta-keto-reductase
Product (GenBank)3-hydroxyacyl-CoA dehydrogenase
Gene
Gene (GenBank)hbdA
EC number1.1.1.35
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Related Reference
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [3-hydroxyacyl-CoA dehydrogenase]
MMGAGLAEVCARAGLDVLVTSSGEDGLARGRGRLERSLAHAVRKDRISDTAREETLARVS
FTTDLAAFRDRQLVLEAAPEDEPTKLRIFQALDRAVEDPEAILATNTSALPVMRLARATD
RPGQVLGLHFFNPAPVLPLVEVIGSLLTRDRTRRIAAEFATTVLGKQVVHAGDRSGFVVN
ALLIPYLLSAIRMCEAGFAGAQDIDKAMTLGCSHPMGPLALADLIGLDTVAAIGTALYEE
FKEPTHAVPPLLSRMVDGGLLGRKSGQGFYTY
selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [3-hydroxyacyl-CoA dehydrogenase]
GTGATGGGCGCGGGCCTCGCCGAAGTGTGCGCCCGGGCCGGGCTCGACGTACTGGTCACG
TCCTCGGGCGAGGACGGGCTGGCCCGGGGCCGCGGCCGGCTCGAACGCTCCCTCGCCCAC
GCCGTCCGCAAGGACAGGATCAGCGACACGGCCCGCGAAGAGACGCTCGCCCGCGTCTCC
TTCACCACCGACCTCGCCGCCTTCCGCGACCGGCAACTGGTCCTGGAGGCGGCCCCCGAG
GACGAGCCCACGAAGCTGCGGATCTTCCAGGCGCTGGACAGGGCCGTCGAGGACCCGGAG
GCGATCCTCGCCACCAACACCTCCGCCCTTCCCGTCATGCGGCTGGCCCGCGCGACCGAC
CGCCCCGGCCAGGTCCTCGGCCTGCACTTCTTCAACCCGGCCCCCGTGCTGCCCCTGGTC
GAGGTGATCGGTTCGCTGCTCACCCGCGACCGCACCCGGCGCATCGCCGCGGAGTTCGCC
ACCACGGTGCTCGGCAAGCAGGTCGTCCACGCCGGCGACCGCTCCGGGTTCGTGGTCAAC
GCCCTGCTGATCCCCTATCTCCTGTCCGCGATCAGGATGTGCGAGGCGGGATTCGCCGGC
GCGCAGGACATCGACAAAGCGATGACACTGGGCTGCTCGCACCCCATGGGACCGCTGGCA
CTGGCCGACCTCATCGGCCTGGACACCGTCGCGGCCATCGGCACGGCCCTGTACGAGGAG
TTCAAGGAGCCCACGCACGCCGTTCCCCCGCTGCTGTCCCGCATGGTCGACGGCGGCCTG
CTCGGCAGGAAGTCCGGGCAGGGTTTCTACACGTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [176-272]  9.29999999999998e-30 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [1-173]  5.30000000000001e-48 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [176-272]  9.00000407957274e-30 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [178-272]  1.8e-31 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [1-177]  2.59999999999998e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022694 3-hydroxyacyl-CoA dehydrogenase (Family)
 [1-272]  5.29999657550189e-32 PIRSF000105
PIRSF000105   HCDH
SignalP No significant hit
TMHMM No significant hit
Oligo_00170 Oligo_00170   last last