close all open/close all
first first   Ovied_00020 Ovied_00020

CDS information : Ovied_00010


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction2 / 1,219 / + [in whole cluster]
2 / 1,219 / + [in contig]
Location2..1219 [in whole cluster]
2..1219 [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glutamate--tRNA ligase(fragment)
putative glutamyl-tRNA synthetase(fragment)
Product (GenBank)tRNA-synthetase class I
GenegltX
Gene (GenBank)
EC number6.1.1.17
Keyword
Note
  • It is supposed that this ORF is not involved in oviedomycin biosynthesis.
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
P04805
PmId
[3015933] Glutamyl-tRNA synthetase of Escherichia coli. Isolation and primary structure of the gltX gene and homology with other aminoacyl-tRNA synthetases. (J Biol Chem. , 1986)
Family/Domain
FD
IPR004527

close this sectionSequence

selected fasta
>putative glutamate--tRNA ligase(fragment) [tRNA-synthetase class I]
DPAFEGPYFQSHNAGRHREAAEGLFAAGRAYYCDCTREQLKERTGSEHLGYDGFCRERGL
GYAAGRALRFRTPDEGETVVADLVRGEPAFPNSAIEDFVIARGDGSPVFLLANVVDDLDE
GITQVIRGEEHLSNTPKQQLLWEALGAGPPVWAHLPVIVNEKRQKLSKRRDKVALEDYLG
EGFLPEALVNYLMLLGWGPGGDREIMPYEELERLFRIEDVNTAPAFFDVKKLTAFNGEYL
RALAPAQFAAACVPWLVAPYAPWRPEAFDKDVFEAAAPLARTRLTRLSEITGYVDFLFLD
EPVDDEVSWHKAMKEGAADILTDVRAGLAAVTGWTAEELKGVLLAVGEQHGLKLGKAQAP
VRVAVTGRTVGLPLFRVPGTGSAGSGCWPGWTPQIRRLAGRGAPG
selected fasta
>putative glutamate--tRNA ligase(fragment) [tRNA-synthetase class I]
GATCCGGCTTTCGAGGGGCCGTACTTCCAGTCGCACAACGCCGGCCGGCACCGGGAGGCG
GCCGAGGGGCTGTTCGCGGCGGGGCGGGCGTACTACTGCGACTGCACCCGGGAGCAGCTG
AAGGAGCGCACGGGGTCGGAGCACCTGGGGTACGACGGGTTCTGCCGGGAGCGGGGGCTC
GGGTACGCGGCCGGGCGGGCGCTGCGGTTCCGGACGCCGGACGAGGGGGAGACCGTCGTC
GCCGACCTGGTGCGCGGCGAGCCGGCGTTCCCGAACAGCGCGATCGAGGACTTCGTGATC
GCCCGCGGTGACGGCTCTCCGGTCTTCCTGCTCGCCAACGTCGTGGACGACCTGGACGAG
GGCATCACGCAGGTCATCCGGGGCGAGGAGCATCTGTCGAACACACCGAAGCAGCAGCTG
CTGTGGGAGGCGCTCGGTGCCGGGCCGCCGGTGTGGGCGCATCTGCCGGTCATCGTGAAC
GAGAAGCGGCAGAAGCTGTCCAAGCGCCGGGACAAGGTCGCGCTGGAGGACTACCTCGGC
GAGGGCTTCCTGCCCGAGGCGCTGGTGAACTACCTGATGCTGCTCGGCTGGGGCCCGGGC
GGCGACCGGGAGATCATGCCGTACGAGGAGCTGGAGCGGCTCTTCCGGATCGAGGACGTC
AACACCGCCCCGGCCTTCTTCGACGTGAAGAAGCTGACGGCCTTCAACGGCGAGTACCTC
CGCGCCCTGGCGCCCGCGCAGTTCGCCGCGGCCTGTGTGCCGTGGCTCGTCGCGCCGTAC
GCCCCGTGGCGGCCGGAGGCGTTCGACAAGGACGTCTTCGAGGCGGCGGCTCCGCTGGCC
CGGACCCGGTTGACGCGGCTCTCCGAGATCACCGGCTACGTGGACTTCCTGTTCCTCGAT
GAGCCGGTGGACGACGAGGTGTCGTGGCACAAGGCGATGAAGGAGGGGGCCGCGGACATC
CTCACGGACGTCCGCGCCGGACTGGCCGCCGTCACCGGCTGGACGGCGGAGGAGCTGAAG
GGCGTCCTGCTCGCCGTGGGGGAGCAGCACGGGCTGAAGCTGGGCAAGGCCCAGGCCCCG
GTCCGGGTCGCGGTCACCGGGCGCACGGTCGGGCTCCCGCTGTTTCGAGTCCCTGGAACT
GGCTCGGCCGGGAGCGGGTGCTGGCCCGGCTGGACACCGCAGATCCGGAGACTGGCGGGG
CGGGGCGCGCCGGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004527 Glutamyl-tRNA synthetase, class Ib, bacterial/mitochondrial (Family)
 [5-375]  2.79999999999994e-89 TIGR00464
TIGR00464   GltX_bact
IPR008925 Aminoacyl-tRNA synthetase, class I, anticodon-binding (Domain)
 [228-377]  2.70000183580794e-27 SSF48163
SSF48163   tRNA-synt_bind
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [96-158]  3.3e-14 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
IPR020058 Glutamyl/glutaminyl-tRNA synthetase, class Ib, catalytic domain (Domain)
 [5-233]  8.79999999999995e-49 PF00749
PF00749   tRNA-synt_1c
IPR020061 Glutamyl/glutaminyl-tRNA synthetase, class Ib, alpha-bundle domain (Domain)
 [160-243]  8.89999999999994e-28 G3DSA:1.10.1160.10
G3DSA:1.10.1160.10   Glu/Gln-tRNA-synth_Ic_a-bdl
IPR020751 Aminoacyl-tRNA synthetase, class I, anticodon-binding domain, subdomain 2 (Domain)
 [300-377]  7.5e-16 G3DSA:1.10.10.350
G3DSA:1.10.10.350   tRNA_synt_bd
SignalP No significant hit
TMHMM No significant hit
first first   Ovied_00020 Ovied_00020