close all open/close all

CDS information : Ovied_00020


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction1,861 / 1,226 / - [in whole cluster]
1,861 / 1,226 / - [in contig]
Locationcomplement(1226..1861) [in whole cluster]
complement(1226..1861) [in contig]
TypeCDS
Length636 bp (211 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
Product (GenBank)putative pyridoxine 5-phosphate oxidase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in oviedomycin biosynthesis.
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Family/Domain
FD
IPR011576

close this sectionSequence

selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [putative pyridoxine 5-phosphate oxidase]
MGRFAHLAYTDSVRRVQEEQGSGLLGVRALAQPDTGPDELGPDEAAFLTTRDGFYLASTG
ETGWPYIQFRGGPAGFVHVLDERRLAWAEVRGNRQYITTGNLRTDGRVALFFMDYARQAR
LKLLGRARTQGLDEDPALTERLDQPRTDGKVERLMIVEVEGFNWNCHQHITPRYTEEELE
TALRPVRARMDALEQENARLRARLAELGEQD
selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [putative pyridoxine 5-phosphate oxidase]
ATGGGACGGTTCGCACACCTCGCCTACACGGACAGCGTGCGCCGCGTCCAGGAGGAGCAG
GGCAGCGGCCTGTTAGGGGTGCGCGCCCTCGCCCAGCCCGACACCGGACCGGACGAACTC
GGCCCCGACGAGGCCGCGTTCCTCACCACCCGGGACGGGTTCTACCTGGCCAGCACGGGC
GAGACCGGCTGGCCCTACATCCAGTTCCGCGGCGGCCCCGCCGGCTTCGTACACGTCCTG
GACGAGCGGCGGCTGGCCTGGGCGGAGGTGCGCGGCAACCGGCAGTACATCACCACCGGG
AACCTGCGGACCGACGGCCGGGTCGCGCTGTTCTTCATGGACTACGCCCGGCAGGCCCGC
CTGAAACTGCTGGGCCGGGCCCGCACCCAGGGACTCGACGAGGACCCCGCGCTCACCGAA
CGGCTCGACCAGCCGCGCACCGACGGCAAGGTGGAGCGCCTGATGATCGTCGAGGTCGAG
GGCTTCAACTGGAACTGCCACCAGCACATCACCCCGCGCTACACCGAGGAGGAGCTGGAG
ACCGCCCTCCGGCCCGTCCGCGCCCGCATGGACGCCCTGGAACAGGAGAACGCCCGCCTG
CGCGCCCGCCTCGCCGAACTCGGCGAGCAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009002 FMN-binding split barrel-related (Domain)
 [37-180]  2.89999717862184e-12 SSF50475
SSF50475   FMN_binding
IPR011576 Pyridoxamine 5'-phosphate oxidase-like, FMN-binding domain (Domain)
 [44-128]  3.5e-07 PF01243
PF01243   Pyridox_oxidase
IPR012349 FMN-binding split barrel (Domain)
 [38-160]  7.79999999999999e-25 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit