close all open/close all

CDS information : Ovied_00040


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction2,389 / 3,627 / + [in whole cluster]
2,389 / 3,627 / + [in contig]
Location2389..3627 [in whole cluster]
2389..3627 [in contig]
TypeCDS
Length1,239 bp (412 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)putative transmembrane efflux protein from the major facilitator superfamily
Gene
Gene (GenBank)ovmE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q0GQS6
PmId
[17935948] A new function for the Bacillus PbuE purine base efflux pump: efflux of purine nucleosides. (Res Microbiol. , 2007)
ACC
P31141
PmId
[1779766] An amplifiable and deletable chloramphenicol-resistance determinant of Streptomyces lividans 1326 encodes a putative transmembrane protein. (Mol Microbiol. , 1991)

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [putative transmembrane efflux protein from the major facilitator superfamily]
MTPPAAQQGRAWRTHACVLALGTFAVGTDAFVIAGLLPDISDSLDISVGAAGQLVSVFSL
AYALLSPVLAAFTARWSRRTVLITGLGVFAVGNVVTALAPDYALVLAARVIAAAGAAMFT
PNAGATAATLAGPEHRGRAIAIVTVGLTASLALGAPLGTVIGEALGWQATMWFVTALALV
VAPVIALRLPDVTLGGPTQLRRRLAPLADRKVAGVLAGTLVAFIGIYLPYTYISAVFEPA
TGGDGDKVAVLLLVFGLAGTAGNLTAGRLADRKGPRTVVIGATLLLTVVFAVMAGVRSSY
PAAVALTAVCGVASWSVTAPQQQRVMALASPGSEPLAVSLNAAVMYLAISLSSALGAGIL
GATGAVWIAWAGAAFAVAAALVTAAAARTERAGAGSAEPEREPAGAQEASAG
selected fasta
>putative major facilitator superfamily transporter [putative transmembrane efflux protein from the major facilitator superfamily]
ATGACCCCTCCCGCCGCACAGCAGGGGCGCGCCTGGCGGACCCACGCCTGTGTGCTCGCA
CTCGGCACGTTCGCCGTCGGCACCGACGCCTTCGTCATCGCCGGCCTGCTCCCCGACATC
AGTGACTCGCTCGACATCTCCGTGGGCGCGGCGGGCCAGCTCGTCAGCGTCTTCTCGCTG
GCCTACGCCCTGCTCTCCCCGGTGCTCGCCGCGTTCACCGCCCGCTGGTCACGCCGTACG
GTGCTGATCACGGGGCTCGGCGTGTTCGCCGTCGGCAACGTGGTCACCGCCCTCGCCCCC
GACTACGCGCTCGTCCTGGCGGCCCGGGTGATCGCCGCGGCCGGCGCCGCGATGTTCACC
CCCAACGCGGGCGCGACCGCGGCGACCCTGGCCGGACCCGAGCACCGGGGCCGGGCGATC
GCCATCGTCACCGTGGGGCTGACCGCCTCGCTCGCGCTGGGCGCGCCGCTCGGCACCGTC
ATCGGCGAGGCGCTGGGCTGGCAGGCCACCATGTGGTTCGTCACCGCGCTCGCCCTGGTC
GTGGCCCCGGTCATCGCCCTGCGGCTGCCCGACGTCACCCTGGGCGGCCCGACCCAGCTG
CGGCGGCGCCTCGCCCCGCTCGCCGACCGCAAGGTCGCCGGGGTACTGGCCGGCACGCTG
GTCGCGTTCATCGGCATCTACCTGCCCTACACCTACATCAGCGCCGTCTTCGAGCCCGCC
ACCGGCGGGGACGGTGACAAGGTGGCCGTACTGCTGCTGGTCTTCGGCCTGGCGGGGACG
GCCGGCAACCTCACCGCGGGCCGGCTCGCCGACCGCAAGGGGCCGCGCACGGTCGTCATC
GGCGCGACGCTGCTGCTGACGGTGGTGTTCGCGGTCATGGCCGGCGTCCGCTCCTCCTAC
CCGGCCGCCGTCGCGCTGACGGCGGTGTGCGGCGTCGCCTCCTGGTCGGTGACCGCGCCG
CAGCAGCAGCGCGTCATGGCGCTGGCCAGCCCCGGCAGCGAGCCCCTGGCCGTCTCCCTC
AACGCCGCCGTGATGTACCTGGCGATCTCGCTGTCCAGCGCGCTGGGCGCCGGGATCCTC
GGTGCGACGGGTGCCGTGTGGATCGCCTGGGCGGGCGCCGCCTTCGCCGTGGCCGCGGCG
CTGGTCACGGCCGCCGCCGCCCGCACCGAGCGGGCCGGCGCCGGGTCCGCGGAGCCGGAG
CGGGAGCCGGCCGGGGCGCAGGAGGCGTCCGCCGGTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [19-235]  7.59999999999998e-34 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-404]  1e-67 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [15-391]  PS50850
PS50850   MFS
SignalP
 [1-30]  0.984 Signal
Eukaryota   
 [1-25]  0.334 Signal
Bacteria, Gram-negative   
TMHMM
 [13-35]  Transmembrane (i-o) [50-72]  Transmembrane (o-i) [81-100]  Transmembrane (i-o) [110-132]  Transmembrane (o-i) [139-161]  Transmembrane (i-o) [171-190]  Transmembrane (o-i) [211-233]  Transmembrane (i-o) [248-270]  Transmembrane (o-i) [277-296]  Transmembrane (i-o) [300-317]  Transmembrane (o-i) [338-360]  Transmembrane (i-o) [365-387]  Transmembrane (o-i)
Transmembrane 12