close all open/close all

CDS information : Ovied_00050


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction3,855 / 4,688 / + [in whole cluster]
3,855 / 4,688 / + [in contig]
Location3855..4688 [in whole cluster]
3855..4688 [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative nucleotide-diphosphate-sugar epimerase
Gene
Gene (GenBank)ovmX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [putative nucleotide-diphosphate-sugar epimerase]
MILVTGATGNVGRNLVRELLEAGARVRALTRDPRRAGLPDGVDVAQGDLTDAESLASALR
GVERAFLFPVHGRLGAFLDAATRAGLKQVVLLSSQSVVDEHLSRERMGRLNAADEQAVIA
SGVPWTFLRPGPFMVNDLPWAWGVKAEGVVRAAYGDAATAPVDERDIAAVAARALLDDDH
VGRAYELTGPQSLTQAERVRILGEVLGRELRFEELSPEAARERMTRHLEAETVDSLLRMF
ARQSGTTVPVSTAVRDVTGRPAHTYAEWAAHHAGDFR
selected fasta
>hypothetical protein [putative nucleotide-diphosphate-sugar epimerase]
ATGATCCTGGTGACCGGTGCGACCGGCAACGTCGGCCGGAACCTGGTGCGCGAACTGCTG
GAAGCGGGAGCGCGGGTACGCGCGCTCACCCGTGACCCGCGCCGCGCCGGCCTGCCGGAC
GGAGTCGACGTGGCCCAGGGAGACCTGACCGATGCCGAGTCCCTCGCCTCCGCGCTGCGC
GGCGTGGAGCGGGCGTTCCTCTTCCCCGTGCACGGCCGGCTGGGCGCGTTCCTGGACGCC
GCGACGCGGGCGGGGCTGAAGCAGGTGGTGCTGCTGTCCTCGCAGTCGGTGGTGGACGAA
CACCTGAGCCGGGAGCGGATGGGCAGGCTCAACGCGGCCGACGAGCAGGCCGTCATCGCC
TCCGGTGTGCCGTGGACGTTCCTGCGCCCCGGCCCGTTCATGGTCAACGACCTGCCGTGG
GCGTGGGGCGTCAAGGCGGAGGGCGTGGTCCGCGCGGCATACGGCGACGCCGCCACCGCG
CCCGTCGACGAGCGGGACATCGCCGCCGTGGCCGCCCGCGCCCTGCTGGACGACGACCAC
GTGGGACGGGCCTACGAGCTGACCGGCCCCCAGTCGCTGACCCAGGCCGAGCGCGTACGC
ATCCTCGGCGAGGTGCTCGGCAGGGAACTGCGCTTCGAGGAACTGTCGCCCGAGGCGGCC
CGGGAGCGGATGACCCGGCACCTGGAGGCGGAGACGGTCGACTCCCTGCTGCGCATGTTC
GCCCGCCAGTCCGGCACGACGGTGCCGGTGTCCACGGCGGTGCGGGACGTCACCGGCCGC
CCGGCGCACACCTACGCCGAGTGGGCGGCCCACCACGCCGGTGACTTCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-211]  1.9e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit