close all open/close all

CDS information : Ovied_00060


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction4,685 / 5,332 / + [in whole cluster]
4,685 / 5,332 / + [in contig]
Location4685..5332 [in whole cluster]
4685..5332 [in contig]
TypeCDS
Length648 bp (215 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)TetR-family transcriptional repressor
Gene
Gene (GenBank)ovmY
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q6TLJ3
PmId
[15033239] Identification and characterization of pltZ, a gene involved in the repression of pyoluteorin biosynthesis in Pseudomonas sp. M18. (FEMS Microbiol Lett. , 2004)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [TetR-family transcriptional repressor]
MTGSRTQAGAEPERKGERTRRRIMEAARRKFAEVGYERATIRAIAAEAGVDKASVIQYFG
TKQELFREAVRWHVPIEELTTPDPARTVDNYLRAMLSSWAADPDSPMAVLLRTSMTSEEA
AELLRRHVTKETVERVAANVDAPDARLRAALSGAMMFGIATQRYLLRMPDLAEADLDDVL
RLAAPLFRTLIAPGSEPGTEPGAAPGTDPETVPGS
selected fasta
>putative TetR family transcriptional regulator [TetR-family transcriptional repressor]
GTGACCGGAAGCCGTACGCAGGCGGGCGCGGAACCGGAGCGCAAGGGCGAGCGCACCCGC
CGGCGGATCATGGAGGCCGCGCGCCGCAAGTTCGCCGAGGTCGGCTACGAACGCGCCACG
ATCCGGGCCATCGCCGCCGAGGCGGGAGTCGACAAGGCGTCCGTCATCCAGTACTTCGGC
ACCAAGCAGGAACTCTTCCGCGAGGCGGTCCGCTGGCACGTCCCGATCGAGGAGCTGACG
ACCCCGGACCCGGCGCGCACGGTCGACAACTACCTCCGCGCCATGCTGAGCAGCTGGGCG
GCCGACCCGGACAGCCCCATGGCGGTGCTGCTGCGCACCAGCATGACCAGCGAGGAGGCC
GCGGAGCTGCTGCGCCGGCATGTGACCAAGGAGACCGTCGAGCGGGTGGCGGCGAACGTC
GACGCCCCGGACGCGCGGCTGCGCGCCGCGCTGTCCGGGGCGATGATGTTCGGCATCGCG
ACCCAGCGGTACCTGCTGCGCATGCCCGACCTGGCCGAGGCCGACCTGGACGACGTACTG
CGCCTGGCGGCACCGCTGTTCCGCACCCTGATCGCCCCCGGCTCGGAGCCGGGGACGGAG
CCGGGGGCGGCACCCGGGACGGATCCGGAGACGGTGCCCGGGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [17-77]  PS50977
PS50977   HTH_TETR_2
 [23-36]  2.2999993566538e-08 PR00455 [44-67]  2.2999993566538e-08 PR00455
PR00455   HTHTETR
 [23-68]  2.4e-15 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [12-68]  1.4e-20 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [7-95]  4.40000933643891e-18 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [84-194]  1.50000306971104e-28 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [69-192]  3.60000000000002e-36 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit