close all open/close all

CDS information : Ovied_00070


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction6,259 / 5,534 / - [in whole cluster]
6,259 / 5,534 / - [in contig]
Locationcomplement(5534..6259) [in whole cluster]
complement(5534..6259) [in contig]
TypeCDS
Length726 bp (241 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)ovmZ protein
Gene
Gene (GenBank)ovmZ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [ovmZ protein]
MSGQPRPNDGSDKQQFQFKKRGNGMRQVLQLSETSEEKPSADALIPTLRTLAELYEECGR
MLAHTPHSLRQRVTGSRATGISLNEKAMAIRTETQNTLGSWARLVVDECGTAGPSREGIP
PLVSFLIRHSGWLAAHPAAGDFAEEIAALVRSARRIAGPGPAHRVDLGRCLRSGCAGTLR
AVVHDGDDATPGQVACDAGHALPPQQWLLVAHRMRRTASRGERVTRRHDGDRAGVREEAA
R
selected fasta
>hypothetical protein [ovmZ protein]
ATGTCCGGCCAGCCACGACCCAACGACGGGTCCGACAAACAGCAATTCCAGTTCAAAAAA
CGGGGAAACGGAATGCGCCAAGTTCTGCAATTGTCAGAAACGTCGGAGGAGAAACCCAGC
GCGGACGCGCTGATCCCAACTCTGCGTACCCTCGCGGAGCTTTACGAGGAATGCGGGCGG
ATGTTAGCGCATACTCCGCACAGCCTGCGCCAGCGTGTCACCGGAAGCCGCGCCACCGGA
ATTTCTCTCAACGAGAAGGCCATGGCGATACGGACGGAGACCCAGAACACGCTCGGTTCC
TGGGCGCGCCTGGTGGTGGACGAGTGCGGCACGGCCGGTCCGTCCCGGGAGGGGATTCCT
CCCCTGGTGTCCTTCCTCATCCGCCATTCCGGATGGCTGGCCGCGCATCCGGCGGCCGGT
GACTTCGCCGAGGAGATCGCCGCGCTCGTGAGGTCCGCCCGCCGTATCGCGGGCCCCGGC
CCCGCCCACCGCGTCGACCTGGGGCGCTGCCTGCGGTCCGGCTGTGCGGGCACGCTGCGT
GCCGTGGTGCACGACGGGGACGACGCGACACCGGGGCAGGTGGCGTGCGACGCCGGGCAC
GCGCTGCCGCCGCAGCAGTGGCTGCTGGTCGCGCACCGCATGCGGCGGACCGCCTCGCGC
GGCGAGCGCGTCACCCGGCGCCACGACGGTGACCGGGCCGGTGTCCGCGAGGAGGCCGCC
CGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit