close all open/close all

CDS information : Ovied_00080


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction6,760 / 7,527 / + [in whole cluster]
6,760 / 7,527 / + [in contig]
Location6760..7527 [in whole cluster]
6760..7527 [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative IclR family transcriptional regulator
Product (GenBank)IclR-family regulator
Gene
Gene (GenBank)ovmR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Family/Domain
FD
IPR005471, IPR014757

close this sectionSequence

selected fasta
>putative IclR family transcriptional regulator [IclR-family regulator]
MDMHAVSADGRTGERVRAGGTTHAERVFRVQQAFLKLRGRTHGPGELAEAAGLDDSAVHR
ILQSGIYEGVFDRVGRGMYQLGTTAALVGMQAMAHTLDRHTARSILLRLRAATGGGLAFL
YTLAPFGGAQRQCVDMAVGDSDLSELGMTPREVLTVTRSLRVGASGRAILAYLPRPLQER
VAAEPAVTEAGPGVLVDDDALWDSLRDIRDQGYAIGLEECIAGWNSCAAPVMWGRLGSSA
RSSCSCRTPSPSART
selected fasta
>putative IclR family transcriptional regulator [IclR-family regulator]
ATGGACATGCACGCGGTTTCGGCCGACGGACGGACCGGCGAGCGCGTCCGTGCGGGCGGC
ACCACGCACGCGGAGCGCGTGTTCCGGGTCCAGCAGGCGTTCCTCAAGCTGCGCGGCCGG
ACGCACGGCCCCGGAGAGCTGGCCGAGGCGGCCGGACTCGACGACTCCGCCGTCCACCGC
ATCCTGCAATCCGGCATCTACGAGGGCGTCTTCGACCGCGTCGGCCGCGGCATGTACCAA
CTCGGCACCACGGCGGCCCTGGTGGGCATGCAGGCCATGGCGCACACCCTCGACCGCCAC
ACCGCCCGGTCGATCCTGCTCAGGCTGCGCGCCGCCACCGGGGGCGGGCTCGCCTTCCTC
TACACGCTCGCCCCGTTCGGCGGCGCCCAGCGGCAGTGTGTCGACATGGCCGTCGGCGAC
TCCGACCTCTCCGAACTCGGCATGACACCCCGCGAGGTGCTGACCGTCACCCGCTCGCTG
CGCGTCGGCGCGTCCGGCCGCGCCATCCTCGCCTACCTCCCGCGCCCCCTCCAGGAACGG
GTGGCCGCCGAGCCCGCCGTGACCGAGGCGGGCCCCGGCGTGCTGGTGGACGACGACGCG
CTGTGGGACTCACTGCGCGACATACGCGACCAGGGCTACGCCATCGGCCTGGAGGAGTGC
ATCGCCGGCTGGAACTCCTGCGCCGCCCCCGTGATGTGGGGACGGCTGGGGTCTTCGGCG
CGGTCCTCGTGCTCCTGCCGGACTCCGAGCCCGTCCGCCCGGACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005471 Transcription regulator IclR, N-terminal (Domain)
 [21-83]  PS51077
PS51077   HTH_ICLR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [20-89]  3.7e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR014757 Transcription regulator IclR, C-terminal (Domain)
 [84-255]  PS51078
PS51078   ICLR_ED
 [160-232]  8.69999999999999e-11 PF01614
PF01614   IclR
SignalP No significant hit
TMHMM No significant hit