close all open/close all

CDS information : Ovied_00100


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction9,556 / 9,888 / + [in whole cluster]
9,556 / 9,888 / + [in contig]
Location9556..9888 [in whole cluster]
9556..9888 [in contig]
TypeCDS
Length333 bp (110 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)cyclase
Gene
Gene (GenBank)ovmC
EC number
Keyword
  • angucycline
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q9XCV6
NITE
Jado_00070
PmId
[11520231] Production of aromatic minimal polyketides by the daunorubicin polyketide synthase genes reveals the incompatibility of the heterologous DpsY and JadI cyclases. (J Nat Prod. , 2001)
ACC
Q93LY5
PmId
[12654660] Engineering anthracycline biosynthesis toward angucyclines. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative cyclase [cyclase]
MKHSTLIVARMEPHASDDVAALFGAFDRTEMPHRMGTRRRQLFKYRGLYFHLQDFDTDNG
GELIEEAKTDPRFIRISEDLKPFIEAYDPQTWRSPKDAMATRFYHWEASA
selected fasta
>putative cyclase [cyclase]
ATGAAGCACAGCACGTTGATCGTGGCCCGGATGGAGCCGCACGCCAGTGACGACGTCGCG
GCCCTCTTCGGCGCCTTCGACAGGACCGAGATGCCCCACCGCATGGGCACCCGCCGCCGT
CAGCTGTTCAAGTACCGGGGCCTGTACTTCCACCTCCAGGACTTCGACACCGACAACGGC
GGCGAGCTGATCGAGGAGGCCAAGACCGACCCGCGCTTCATCCGGATCAGCGAGGACCTC
AAGCCGTTCATCGAGGCGTACGACCCGCAGACGTGGCGCTCGCCCAAGGACGCGATGGCC
ACGCGCTTCTACCACTGGGAGGCCTCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [11-108]  3.99999999999998e-43 PF04673
PF04673   Cyclase_polyket
 [1-108]  PD012644
PD012644   Polyketide_synth_cyclase
 [3-109]  1.09999999999999e-50 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [2-109]  5.50001754266469e-45 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit