close all open/close all

CDS information : Ovied_00110


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction9,885 / 11,009 / + [in whole cluster]
9,885 / 11,009 / + [in contig]
Location9885..11009 [in whole cluster]
9885..11009 [in contig]
TypeCDS
Length1,125 bp (374 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)keto-acyl synthase alpha
Gene
Gene (GenBank)ovmP
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q56163
NITE
Jado_00080
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)
[15817470] Functional analyses of oxygenases in jadomycin biosynthesis and identification of JadH as a bifunctional oxygenase/dehydrase. (J Biol Chem. , 2005)
[15776503] The oxidative ring cleavage in jadomycin biosynthesis: a multistep oxygenation cascade in a biosynthetic black box. (Chembiochem. , 2005)

close this sectionPKS/NRPS Module

KS4..364

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [keto-acyl synthase alpha]
MTPRRVVITGIGVLAPGGIGVKNFWSLLSEGRTATRGITFFDPAQFRSRVAAEIDFDPEE
HGLNPQETRRMDRAAQLAVVATREAVADSGIELTGIDPYRVGVTVGSAVGATMGLDQEYR
VVSNGGLLDLVDHTYAVPHLYNHMVPSSFAAEVAWQVGAEGPSTVVSTGCTSGLDSVGHA
VELIREGSADVMIAGSSDAPISPITMACFDAIKATTPRNDDPEHASRPFDGTRNGFVLGE
GSAFFVLEELESARARGAHVYAEIAGYATRSNAYHMTGLRPDGAEMAEAIRVALDEARIN
GDEIDYINAHGSGTKQNDRHETAAFKKSLGDHAYRTPVSSIKSMVGHSLGAIGSIEIAAS
ALAMVLARPERSVA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [keto-acyl synthase alpha]
ATGACGCCCCGGCGCGTCGTCATCACCGGCATCGGCGTGCTCGCGCCGGGCGGCATCGGT
GTGAAGAACTTCTGGAGCCTGCTGAGCGAGGGCCGCACCGCGACCCGCGGCATCACCTTC
TTCGACCCCGCCCAGTTCCGCTCGCGGGTCGCCGCCGAGATCGACTTCGATCCGGAGGAA
CACGGGCTGAACCCGCAGGAGACACGGCGCATGGACCGCGCCGCCCAGCTCGCCGTCGTG
GCCACCCGCGAGGCGGTCGCCGACAGCGGCATCGAGCTGACCGGCATCGACCCGTACCGC
GTCGGCGTCACCGTGGGCAGCGCGGTCGGCGCGACCATGGGGCTGGACCAGGAGTACCGG
GTCGTCAGCAACGGCGGCCTGCTCGACCTGGTCGACCACACGTACGCGGTCCCGCACCTG
TACAACCACATGGTCCCCAGCTCCTTCGCCGCCGAGGTCGCCTGGCAGGTGGGCGCGGAG
GGCCCCAGCACGGTGGTCTCCACCGGCTGCACCTCCGGCCTGGACTCGGTCGGCCACGCG
GTGGAGCTGATCCGCGAGGGCTCGGCGGACGTCATGATCGCCGGCTCGTCGGACGCGCCG
ATCTCGCCTATCACCATGGCGTGCTTCGACGCGATCAAGGCGACGACCCCGCGCAACGAC
GACCCCGAGCACGCCTCCCGCCCCTTCGACGGCACCCGCAACGGCTTCGTGCTCGGCGAG
GGCTCCGCCTTCTTCGTACTGGAGGAGCTGGAGAGCGCCCGCGCGCGCGGCGCCCACGTC
TACGCCGAGATCGCCGGCTACGCCACCCGCTCCAACGCGTACCACATGACCGGGCTGCGC
CCCGACGGCGCCGAGATGGCCGAGGCCATCCGCGTCGCGCTCGACGAGGCCCGGATCAAC
GGCGACGAGATCGACTACATCAACGCGCACGGCTCCGGCACCAAGCAGAACGACCGGCAC
GAGACGGCCGCGTTCAAGAAGAGCCTCGGCGACCACGCGTACCGCACCCCGGTCTCCTCC
ATCAAGTCGATGGTGGGCCACTCGCTGGGCGCGATCGGCTCCATCGAGATCGCCGCGTCC
GCCCTGGCCATGGTGCTCGCCCGGCCCGAGAGGAGCGTGGCATGA
KS4..364
KS10..1092

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-252]  1.29999999999998e-63 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-364]  7.4e-33 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-266]  3.49999999999995e-68 G3DSA:3.40.47.10 [271-364]  2.1e-31 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-258]  2.39999798157263e-71 SSF53901 [220-364]  6.89998448199219e-47 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [161-177]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-20]  0.746 Signal
Eukaryota   
TMHMM No significant hit