close all open/close all

CDS information : Ovied_00120


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction11,006 / 12,229 / + [in whole cluster]
11,006 / 12,229 / + [in contig]
Location11006..12229 [in whole cluster]
11006..12229 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)keto-acyl synthase beta
Gene
Gene (GenBank)ovmK
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q56164
NITE
Jado_00090
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionPKS/NRPS Module

CLF6..365

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [keto-acyl synthase beta]
MTGTATKVVVTGLGVAAPNGLGTQDYWAATRTGKGGIGRITRFDPSQYPSRLAGEVPGFE
ARDHLPSRLLPQTDHMTRLALVAADWALADAGVKPQELPEFDMGVVTASSSGGFEFGQRE
LQALWSKGGQHVSAYQSFAWFYAVNSGQISIRNGMKGPSGVVVSEQAGGLDALAQARRQI
RKGTRLIVSGGMDASVCTWGWVAQLAGKRLSTSDDPERAYLPFDAGARGHVPGEGGAILI
LENAEAARSRGARTYGEIAGYGSTFDPKPGSGRPPGLRKAIELALADAGAAPDEVDVVFA
DAAAVPELDRIEAEALTAVFGARGVPVTAPKTMTGRLYSGAAPLDVATALLAIEEGLIPP
TTNVEPADGYDLDLVTGEARPAEVRTALVLARGFNGFNSALVVRATH
selected fasta
>polyketide synthase chain length factor subunit [keto-acyl synthase beta]
ATGACCGGCACGGCCACGAAGGTGGTGGTCACCGGACTGGGCGTCGCGGCCCCCAACGGC
CTGGGCACCCAGGACTACTGGGCGGCGACCCGGACCGGCAAGGGCGGCATCGGCCGCATC
ACCCGCTTCGACCCCTCGCAGTACCCCTCCCGGCTGGCCGGCGAGGTCCCCGGCTTCGAG
GCCCGCGACCACCTGCCCAGCCGGCTGCTGCCGCAGACCGACCACATGACGCGGCTCGCG
CTCGTGGCCGCCGACTGGGCGCTCGCCGACGCCGGGGTCAAGCCGCAGGAGCTGCCCGAG
TTCGACATGGGCGTGGTCACCGCCAGCTCCTCGGGCGGCTTCGAGTTCGGCCAGCGCGAA
CTCCAGGCGCTGTGGAGCAAGGGCGGCCAGCACGTCAGCGCCTACCAGTCCTTCGCCTGG
TTCTACGCGGTCAACTCCGGCCAGATTTCGATTCGCAACGGCATGAAGGGGCCCAGCGGC
GTCGTCGTCAGCGAGCAGGCGGGCGGCCTCGACGCGCTCGCCCAGGCCCGCCGGCAGATC
CGCAAGGGCACCCGGCTGATCGTCTCCGGCGGCATGGACGCGTCCGTGTGCACCTGGGGG
TGGGTCGCCCAGCTGGCCGGCAAGCGGCTGAGCACCAGCGACGACCCCGAGCGCGCCTAC
CTGCCGTTCGACGCCGGGGCGCGCGGGCACGTCCCGGGCGAGGGCGGCGCGATCCTCATC
CTGGAGAACGCCGAGGCCGCCCGGTCCCGGGGCGCCCGGACCTACGGCGAGATCGCGGGC
TACGGCTCCACGTTCGACCCCAAGCCGGGCAGCGGCCGCCCGCCGGGCCTGCGCAAGGCG
ATCGAGCTGGCCCTCGCGGACGCGGGCGCGGCCCCGGACGAGGTGGACGTGGTGTTCGCC
GACGCCGCCGCCGTCCCGGAGCTGGACCGCATCGAGGCCGAGGCGCTCACCGCCGTCTTC
GGCGCCCGCGGCGTCCCGGTCACCGCGCCCAAGACCATGACCGGCCGCCTGTACTCCGGC
GCCGCCCCGCTGGACGTGGCCACCGCGCTGCTCGCCATCGAGGAGGGGCTGATCCCGCCC
ACCACGAACGTCGAGCCGGCCGACGGCTACGACCTGGACCTGGTCACCGGCGAGGCCCGC
CCGGCCGAGGTGCGCACGGCGCTCGTGCTGGCCCGCGGCTTCAACGGGTTCAACTCCGCG
CTCGTGGTCCGCGCCACCCACTGA
CLF6..365
CLF16..1095

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [6-246]  1e-57 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [255-365]  1.1e-27 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [6-260]  1.6e-55 G3DSA:3.40.47.10 [272-405]  1.5e-39 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [5-252]  2.60000517657733e-63 SSF53901 [215-406]  6.70002630158883e-49 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-28]  0.305 Signal
Bacteria, Gram-positive   
 [1-22]  0.584 Signal
Eukaryota   
TMHMM No significant hit