close all open/close all

CDS information : Ovied_00140


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction12,706 / 13,488 / + [in whole cluster]
12,706 / 13,488 / + [in contig]
Location12706..13488 [in whole cluster]
12706..13488 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)ketoreductase
Gene
Gene (GenBank)ovmT
EC number
Keyword
Note
Note (GenBank)
  • actIII homologue
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
MAQDKRVALVTGATSGIGLAVARLLAEQGHRVFLGARSAENVAATVKELQSAGLEADGAT
LDVRSDADVHAFVRAAVDRFGTVDVLVNNAGRSGGGVTADIADELWHDVIDTNLNSVFRL
TREVLNTGGLRHKSWGRIINIASTAGKQGVVLGAPYSASKHGVVGFTKALGNELAPTGIT
VNAVCPGYVETPMAQRVRQGYAAAYDTTEDAILEKFQSKIPLGRYSTPEEVAGLVGYLAS
DTAASITAQALNVCGGLGNF
selected fasta
>putative polyketide C-9 ketoreductase [ketoreductase]
ATGGCGCAGGACAAGCGGGTCGCCCTGGTGACCGGGGCGACCAGCGGCATCGGTCTGGCC
GTGGCCCGGCTGCTGGCCGAGCAGGGGCACCGGGTGTTCCTGGGCGCGCGCAGCGCCGAG
AACGTGGCCGCGACCGTGAAGGAACTGCAGAGCGCCGGCCTGGAGGCGGACGGCGCCACG
CTGGACGTCCGCTCCGACGCCGACGTCCACGCCTTCGTGCGGGCGGCCGTGGACCGGTTC
GGCACGGTGGACGTGCTGGTGAACAACGCCGGCCGCAGCGGTGGCGGAGTGACCGCGGAC
ATCGCCGACGAGCTGTGGCACGACGTGATCGACACGAACCTCAACAGCGTGTTCCGGCTG
ACCCGCGAGGTGCTGAACACCGGTGGCCTCAGGCACAAGAGCTGGGGCCGGATCATCAAC
ATCGCCTCCACCGCGGGCAAGCAGGGCGTCGTCCTGGGCGCCCCGTACTCGGCGTCCAAG
CACGGCGTGGTCGGCTTCACCAAGGCCCTCGGCAACGAGCTGGCCCCGACCGGGATCACC
GTCAACGCGGTCTGCCCGGGCTACGTCGAGACGCCGATGGCCCAGCGGGTGCGCCAGGGC
TACGCCGCCGCCTACGACACCACCGAGGACGCGATCCTGGAGAAGTTCCAGTCCAAGATC
CCGCTCGGCCGCTACTCCACCCCCGAGGAGGTCGCCGGGCTGGTCGGCTACCTGGCCTCC
GACACCGCCGCCTCCATCACCGCCCAGGCGCTCAACGTCTGCGGCGGCCTCGGCAACTTC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [81-92]  5.79999653854781e-15 PR00080 [136-144]  5.79999653854781e-15 PR00080 [156-175]  5.79999653854781e-15 PR00080
PR00080   SDRFAMILY
 [1-260]  5.20000089003336e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
 [7-174]  5.30000000000001e-36 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [7-24]  7.90003079443025e-50 PR00081 [81-92]  7.90003079443025e-50 PR00081 [130-146]  7.90003079443025e-50 PR00081 [156-175]  7.90003079443025e-50 PR00081 [177-194]  7.90003079443025e-50 PR00081 [221-241]  7.90003079443025e-50 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-257]  4.49999999999996e-83 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [143-171]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-26]  0.806 Signal
Eukaryota   
 [1-26]  0.925 Signal
Bacteria, Gram-positive   
 [1-22]  0.819 Signal
Bacteria, Gram-negative   
TMHMM
 [7-26]  Transmembrane (i-o)
Transmembrane 1