close all open/close all

CDS information : Ovied_00150


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction13,516 / 14,463 / + [in whole cluster]
13,516 / 14,463 / + [in contig]
Location13516..14463 [in whole cluster]
13516..14463 [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)aromatase
Gene
Gene (GenBank)ovmA
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q56167
NITE
Jado_00120
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [aromatase]
MTTREVEHEITIAAPAEAVYRLLADVENWPRIFPPTIFADRLEGGETEERIRIWATANGE
AKNWTSRRTLEPRGLVITFRQEVSAPPVAAMGGTWIIEPAGESAARVRLLHDYRAVDDDP
AGLAWIDEAVDRNSRTELASLKTNVEFAHAAREITFSFEDTVRIDGSAKDVYDFINDAHL
WSERLPHVASVRCEEEYPGLQTLEMDTRAKDGSTHTTKSYRVCFPHRKIAYKQVTLPALM
NLHTGYWTFTEDADGVSASSQHTVVLNTDNITRILGPDAGIPEARAYVQSALSTNSRATL
GHAKDYAEARRNHAD
selected fasta
>putative cyclase/dehydratase [aromatase]
ATGACCACCCGTGAGGTCGAGCACGAGATCACCATCGCCGCCCCGGCCGAGGCGGTGTAC
CGGCTGCTGGCCGACGTGGAGAACTGGCCGCGCATCTTCCCGCCCACCATCTTCGCCGAC
CGCCTGGAGGGCGGGGAGACCGAGGAGCGGATCCGGATCTGGGCCACCGCCAACGGCGAG
GCCAAGAACTGGACGTCCCGCCGCACCCTGGAACCGCGGGGCCTTGTGATCACCTTCCGC
CAGGAGGTGTCCGCCCCGCCGGTCGCGGCCATGGGCGGCACCTGGATCATCGAGCCGGCC
GGCGAGTCCGCGGCCCGGGTGCGGCTGCTGCACGACTACCGCGCCGTCGACGACGACCCG
GCCGGCCTGGCCTGGATCGACGAGGCCGTCGACCGCAACTCCCGCACCGAGCTGGCCTCG
CTGAAGACCAACGTGGAGTTCGCGCACGCCGCGCGGGAGATCACCTTCTCCTTCGAGGAC
ACCGTCCGCATCGACGGGTCGGCCAAGGACGTGTACGACTTCATCAACGACGCCCACCTG
TGGTCCGAGCGGCTGCCGCACGTGGCCAGCGTGCGCTGCGAGGAGGAGTACCCGGGCCTG
CAGACCCTGGAGATGGACACCCGGGCCAAGGACGGCTCGACCCACACCACCAAGTCGTAC
CGGGTCTGCTTCCCGCACCGGAAGATCGCCTACAAGCAGGTCACGCTGCCCGCGCTGATG
AACCTGCACACCGGCTACTGGACCTTCACCGAGGACGCGGACGGGGTGTCGGCCTCCTCC
CAGCACACCGTCGTCCTCAACACCGACAACATCACGCGGATCCTCGGCCCCGACGCCGGC
ATCCCCGAGGCCCGCGCCTACGTGCAGAGCGCGCTGAGCACCAACAGCCGCGCCACCCTC
GGCCACGCCAAGGACTACGCCGAAGCACGGCGGAACCATGCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [5-146]  1.6e-15 PF10604 [156-305]  1.4e-08 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [5-114]  1.2e-17 G3DSA:3.30.530.20 [158-255]  1.2e-17 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit