close all open/close all

CDS information : Ovied_00170


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction15,945 / 17,465 / + [in whole cluster]
15,945 / 17,465 / + [in contig]
Location15945..17465 [in whole cluster]
15945..17465 [in contig]
TypeCDS
Length1,521 bp (506 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Producthydroxylase
Product (GenBank)oxygenase
Gene
Gene (GenBank)ovmOIII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
[18988223] Elucidation of oxygenation steps during oviedomycin biosynthesis and generation of derivatives with increased antitumor activity. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hydroxylase [oxygenase]
MSKSAPRPPAGPRTATGPEVLVVGAGPTGLLLAGDLAAAGTRVTVLEKRGRKLSNLTRSF
TVHARTLEQLQARGVAEDIIATGTKLPTLPLFGDLDIHFAHLRTRYPYVLITPQFHVEQV
LERRAVSLGVEFRHDTEVTGLRQDAHGVELDAVTADGTRETHRAAYAVGTDGVRSTVRRL
LDIPFPGDSVLRSVILADVLMKEAPADLLTVDANEHGFAFVAPFGDGYYRVLAWNRHTDS
SADESVDFEELRRLCRAILGRDFGMHEPRWVSRFHSDERQATRYREGRFFLAGDAAHVHS
PAGGMGMNTGLQDAMNLAWKLAAAVRGHGDDALLDTYEAETHPVGEEVLRTSGSLVRAAI
RQSGRTRLAQQAMVWFAGHLGPLGEALGRREGLAVSGTGITYGRQRGDHRLVGRFFHGRL
TGGRLDGALGTGRFVLLSPDEAVRTAVADWSDRVVTAPADVRTTLLIRPDGYVAWAADGP
GPAAVRDALNRWAGPAEPRIRLAYAG
selected fasta
>hydroxylase [oxygenase]
ATGTCGAAGTCCGCACCGCGGCCCCCGGCGGGCCCCCGCACGGCGACCGGCCCCGAGGTC
CTGGTCGTCGGGGCGGGCCCCACCGGCCTGCTGCTGGCGGGAGACCTCGCCGCCGCCGGC
ACCCGGGTCACCGTCCTGGAGAAGCGCGGCCGGAAACTGAGCAACCTGACCCGCTCGTTC
ACCGTGCACGCGCGCACCCTGGAGCAGCTTCAGGCGCGCGGCGTCGCCGAGGACATCATC
GCCACCGGCACCAAGCTGCCCACCCTGCCGCTCTTCGGCGACCTGGACATCCACTTCGCG
CACCTGCGCACCCGCTACCCGTACGTGCTGATCACCCCGCAGTTTCACGTGGAACAAGTG
CTGGAGCGACGGGCCGTCTCCCTCGGGGTGGAGTTCCGCCACGACACCGAGGTGACCGGG
CTGCGCCAGGACGCGCACGGGGTCGAGCTGGACGCCGTCACCGCCGACGGCACCCGGGAG
ACCCACCGTGCGGCCTACGCGGTCGGCACCGACGGGGTGCGCAGCACCGTGCGGCGGCTG
CTGGACATCCCCTTCCCCGGCGACTCCGTGCTGCGCTCGGTGATCCTCGCCGACGTGCTG
ATGAAGGAGGCGCCCGCCGACCTGCTCACCGTGGACGCCAACGAGCACGGGTTCGCCTTC
GTCGCCCCCTTCGGCGACGGCTACTACCGCGTGCTCGCCTGGAACCGGCACACCGACAGC
TCGGCGGACGAGTCCGTGGACTTCGAGGAGCTGCGCCGGCTGTGCCGGGCCATTCTCGGC
CGGGACTTCGGCATGCACGAGCCGCGCTGGGTCTCGCGCTTCCACAGCGACGAGCGCCAG
GCCACCCGGTACCGCGAGGGCCGCTTCTTCCTGGCCGGCGACGCCGCGCACGTCCACTCG
CCGGCCGGCGGCATGGGCATGAACACCGGCCTGCAGGACGCGATGAACCTCGCCTGGAAG
CTGGCGGCGGCGGTGCGCGGCCACGGCGACGACGCCCTGCTCGACACCTACGAGGCGGAG
ACCCATCCGGTCGGCGAGGAGGTGCTGCGCACCTCGGGCTCCCTGGTCCGCGCGGCCATC
CGGCAGAGCGGACGCACCCGGCTCGCCCAGCAGGCGATGGTCTGGTTCGCCGGACACCTC
GGCCCGCTCGGCGAGGCACTGGGCCGCCGGGAGGGCCTGGCCGTCTCCGGCACCGGTATC
ACCTACGGCCGGCAGCGCGGCGACCACCGGCTCGTCGGCCGGTTCTTCCACGGGCGGCTG
ACCGGCGGACGGCTCGACGGCGCCCTGGGCACCGGCCGGTTCGTGCTGCTCAGCCCCGAC
GAGGCCGTGCGCACGGCGGTGGCGGACTGGTCCGACCGCGTCGTGACCGCCCCCGCGGAC
GTCCGCACCACGCTGCTCATCCGGCCGGACGGGTACGTCGCCTGGGCGGCCGACGGCCCC
GGCCCGGCGGCGGTCCGCGACGCCCTGAACCGCTGGGCGGGCCCGGCGGAACCCCGGATC
CGGCTTGCGTACGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [19-351]  8.19999999999987e-84 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [19-41]  3.59998852907783e-44 PR00420 [163-178]  3.59998852907783e-44 PR00420 [286-301]  3.59998852907783e-44 PR00420 [301-317]  3.59998852907783e-44 PR00420 [319-337]  3.59998852907783e-44 PR00420 [337-353]  3.59998852907783e-44 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-39]  0.83 Signal
Eukaryota   
 [1-39]  0.413 Signal
Bacteria, Gram-positive   
TMHMM No significant hit