close all open/close all

CDS information : Ovied_00180


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction17,521 / 18,402 / + [in whole cluster]
17,521 / 18,402 / + [in contig]
Location17521..18402 [in whole cluster]
17521..18402 [in contig]
TypeCDS
Length882 bp (293 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)4'-phosphopantetheinyl transferase
Gene
Gene (GenBank)ovmF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
Q9L7M4
NITE
Jado_00180
PmId
[11390684] Cloning and functional analysis of a phosphopantetheinyl transferase superfamily gene associated with jadomycin biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 2001)
ACC
Q9RFL1
NITE
Myxo_00010
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)
[11134965] The mtaA gene of the myxothiazol biosynthetic gene cluster from Stigmatella aurantiaca DW4/3-1 encodes a phosphopantetheinyl transferase that activates polyketide synthases and polypeptide synthetases. (J Biochem. , 2001)
Family/Domain
FD
IPR008278

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [4'-phosphopantetheinyl transferase]
MPDGRRVDLWLLRCPGPGTPPGPHVRAGPHVRADTRVRPDPDVRPAPDPLADPGVLDVLD
AAERKRAASLRRPADRALYVASHLALRTLLGAYLRVPAREVVLVREPCPGCGGPHGRPAV
PGTPPPLHFSLSHSHGLALIGVAAVPVGVDVQRVPGPGTVDACAPSLHPAERAELERLPP
GARPGAFAQLWARKEAYLKGIGTGLSRPASADYLGADTRSRPHGWTVTDLPRADGHTAAV
AVLGTAPPAPAVRRLPVRLTSPHRLTTMHQAANDHEPTDQLARQPEGTHEETA
selected fasta
>putative phosphopantetheinyl transferase [4'-phosphopantetheinyl transferase]
GTGCCGGACGGCCGGCGCGTGGACCTGTGGCTGCTGCGCTGCCCCGGACCGGGCACCCCG
CCCGGCCCTCACGTACGGGCCGGTCCTCACGTACGGGCCGACACCCGCGTACGCCCCGAC
CCGGACGTACGCCCCGCCCCGGACCCTCTCGCCGACCCGGGCGTCCTCGACGTACTCGAC
GCGGCGGAGCGGAAGCGGGCGGCCTCCCTGCGCCGGCCCGCCGACCGGGCCCTCTACGTC
GCCTCGCACCTCGCCCTGCGCACCCTGCTCGGCGCCTACCTGCGCGTCCCCGCGCGGGAG
GTGGTCCTCGTCCGCGAGCCGTGCCCGGGGTGCGGCGGCCCGCACGGCCGCCCGGCGGTC
CCGGGCACCCCGCCCCCGCTGCACTTCTCCCTCTCGCACAGCCACGGCCTGGCCCTGATC
GGGGTGGCGGCGGTCCCCGTCGGCGTCGATGTGCAGCGGGTGCCGGGTCCCGGCACCGTC
GACGCCTGCGCCCCTTCGCTGCACCCGGCCGAACGCGCCGAACTGGAGCGGCTGCCGCCC
GGCGCACGCCCCGGCGCGTTCGCCCAGCTGTGGGCGCGCAAGGAGGCGTACCTCAAGGGC
ATCGGCACCGGCCTGAGCCGCCCCGCGTCCGCCGACTACCTCGGCGCCGACACCCGGTCC
CGGCCGCACGGCTGGACGGTCACCGACCTGCCCCGCGCCGACGGCCACACCGCGGCGGTC
GCCGTCCTCGGCACGGCGCCCCCGGCCCCGGCCGTGCGCCGGCTGCCCGTGCGCCTCACC
TCACCTCACCGACTGACGACCATGCACCAGGCCGCCAACGACCACGAGCCCACCGACCAG
TTGGCAAGGCAACCGGAGGGTACCCATGAGGAAACAGCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [146-211]  1.3e-08 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [146-206]  9.10000000000001e-09 PF01648
PF01648   ACPS
 [55-151]  3.00000067992871e-21 SSF56214 [145-264]  1.89999859865865e-23 SSF56214
SSF56214   4-PPT_transf
SignalP No significant hit
TMHMM No significant hit