close all open/close all

CDS information : Ovied_00190


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction18,386 / 19,930 / + [in whole cluster]
18,386 / 19,930 / + [in contig]
Location18386..19930 [in whole cluster]
18386..19930 [in contig]
TypeCDS
Length1,545 bp (514 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productacyl-CoA carboxylase beta subunit
Product (GenBank)acetyl-CoA carboxylase complex, beta-chain
Gene
Gene (GenBank)ovmG
EC number6.4.1.-
Keyword
  • malonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
[24148183] Engineering precursor metabolite pools for increasing production of antitumor mithramycins in Streptomyces argillaceus. (Metab Eng. , 2013)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>acyl-CoA carboxylase beta subunit [acetyl-CoA carboxylase complex, beta-chain]
MRKQLDELLDIKESARGGPDPDATRRQHDKGKLTARERIELLLDKDSFQEIEQLRRHRAT
GFGLEAKKPYTDGVITGWGTVHGRTVFVYAHDFRIFGGALGEAHAQKIHKLMDMAIAAGA
PLVSLNDGAGARIQEGVTALAGYGGIFQRNTRASGVIPQISVMLGPCAGGAAYSPALTDF
VFMVRGTSQMFITGPDVVRAVTGEEIGQEGLGGADVHSRTSGVAHFAYDDEETCLEEVRF
LLSMLPANNRESAPAVPCDDPADRRGQALYDLVPADGNRPYDMRAVIEEIVDDGTHLEVH
ERWATNVICTLARLDGKVVGIVANQPQSLAGVLDIAASEKAASFVQTCDSFNIPLVTLLD
VPGFLPGVDQEHNGIIRHGAKLLYAYCNATVPRISLVLRKAYGGAYIVMDSRSIGADLAL
AWPTNEIAVMGAEGAAGVIFRRDINAADDPEAVRRQRVEEYKAELMHPYYAAERGLVDDV
IDPADTREVLIRGLAMLRTKHADLPMRKHGNPPQ
selected fasta
>acyl-CoA carboxylase beta subunit [acetyl-CoA carboxylase complex, beta-chain]
ATGAGGAAACAGCTTGACGAGCTGCTCGACATCAAGGAGTCGGCCCGGGGCGGCCCGGAT
CCGGACGCGACGCGCCGCCAGCACGACAAGGGCAAGCTCACCGCCCGCGAACGCATCGAG
CTGCTGCTCGACAAGGACTCCTTCCAGGAGATCGAGCAGCTGCGCCGGCACCGCGCGACC
GGCTTCGGCCTGGAGGCGAAGAAGCCGTACACCGACGGCGTGATCACCGGCTGGGGCACG
GTCCACGGCCGGACCGTCTTCGTCTACGCGCACGACTTCCGCATCTTCGGCGGCGCGCTC
GGCGAGGCCCACGCCCAGAAGATCCACAAGCTGATGGACATGGCGATCGCGGCCGGTGCG
CCGCTGGTGTCGCTCAACGACGGCGCCGGCGCCCGCATCCAGGAGGGTGTCACCGCGCTC
GCCGGCTACGGCGGCATCTTCCAGCGCAACACCCGCGCCTCCGGTGTCATCCCGCAGATC
AGCGTCATGCTCGGCCCGTGCGCGGGCGGCGCCGCCTACAGCCCGGCGCTGACGGACTTC
GTCTTCATGGTGCGCGGCACCTCGCAGATGTTCATCACCGGCCCCGACGTGGTCCGCGCG
GTGACCGGCGAGGAGATCGGCCAGGAGGGGCTGGGCGGCGCGGACGTCCACTCCCGGACC
TCGGGCGTCGCGCACTTCGCGTACGACGACGAGGAGACCTGCCTGGAGGAGGTCCGCTTC
CTGCTGTCGATGCTGCCCGCCAACAACCGCGAGAGCGCCCCGGCCGTGCCCTGCGACGAC
CCGGCGGACCGGCGCGGCCAGGCCCTGTACGACCTGGTCCCGGCCGACGGCAACCGGCCG
TACGACATGCGGGCCGTCATCGAGGAGATCGTCGACGACGGCACCCACCTGGAGGTCCAC
GAACGCTGGGCCACCAACGTCATCTGCACGCTGGCCCGCCTCGACGGCAAGGTGGTCGGC
ATCGTCGCCAACCAGCCGCAGTCCCTGGCGGGCGTGCTGGACATCGCCGCGTCCGAGAAG
GCCGCGAGCTTCGTGCAGACCTGCGACTCCTTCAACATCCCCCTCGTGACCCTGCTGGAC
GTGCCCGGCTTCCTGCCCGGCGTGGACCAGGAGCACAACGGCATCATCCGGCACGGCGCC
AAGCTGCTGTACGCGTACTGCAACGCGACCGTGCCCCGGATCTCCCTGGTGCTGCGCAAG
GCGTACGGCGGCGCCTACATCGTCATGGACTCCCGCTCCATCGGCGCCGACCTGGCGCTG
GCCTGGCCCACCAACGAGATCGCGGTGATGGGCGCCGAGGGCGCGGCGGGCGTCATCTTC
CGGCGGGACATCAACGCCGCCGACGACCCCGAGGCCGTGCGCCGGCAGCGCGTCGAGGAG
TACAAGGCCGAGCTGATGCACCCCTACTACGCCGCCGAACGCGGCCTGGTGGACGACGTG
ATCGACCCGGCCGACACCCGCGAGGTGCTGATCCGCGGCCTGGCGATGCTGCGCACCAAG
CACGCCGACCTGCCGATGCGCAAGCACGGCAACCCGCCCCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [26-511]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [7-221]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [222-506]  PS50989
PS50989   COA_CT_CTER
SignalP
 [1-17]  0.039 Signal
Eukaryota   
TMHMM No significant hit