close all open/close all

CDS information : Ovied_00195


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction19,956 / 20,165 / + [in whole cluster]
19,956 / 20,165 / + [in contig]
Location19956..20165 [in whole cluster]
19956..20165 [in contig]
TypeCDS
Length210 bp (69 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productacyl-CoA carboxylase epsilon subunit
Product (GenBank)
Gene
Gene (GenBank)ovmI
EC number6.4.1.-
Keyword
  • malonyl-CoA
Note
Note (GenBank)
Reference
PmId
[24148183] Engineering precursor metabolite pools for increasing production of antitumor mithramycins in Streptomyces argillaceus. (Metab Eng. , 2013)
Related Reference
ACC
O86518
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>acyl-CoA carboxylase epsilon subunit
MSTTEPLFRIVRGQADAEELAALTAVLTVLAQRAGASAEPAAPRPAAARWFRLERNAGFL
ASHSWQTAS
selected fasta
>acyl-CoA carboxylase epsilon subunit
ATGAGCACCACTGAGCCCCTCTTCCGGATCGTCCGGGGACAGGCCGACGCCGAGGAACTC
GCCGCCCTGACGGCCGTACTGACCGTGCTCGCGCAGCGGGCGGGCGCCTCGGCGGAACCG
GCCGCCCCGCGTCCGGCGGCCGCGCGCTGGTTCCGGCTGGAGCGCAACGCCGGATTCCTG
GCCTCGCACAGCTGGCAGACCGCCTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit