close all open/close all

CDS information : Ovied_00210


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction22,765 / 22,247 / - [in whole cluster]
22,765 / 22,247 / - [in contig]
Locationcomplement(22247..22765) [in whole cluster]
complement(22247..22765) [in contig]
TypeCDS
Length519 bp (172 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MarR family transcriptional regulator
Product (GenBank)putative MarR-family repressor
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in oviedomycin biosynthesis.
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>putative MarR family transcriptional regulator [putative MarR-family repressor]
MGDRQQAVDRVDVIMKQVAQVSTAPDLTSKELCQRIQRVAHHLETRLRRELAVFGIEPWE
IELLASLRRVGPPHQVTAGSLQDIMQLTTGAVTKRVAALEKKGWVRREVDAGDRRQVLVC
LTDEGEQRALEVFATKTETEARVLSALDLDTQRRLNDDLRTLLIDLEGAVRT
selected fasta
>putative MarR family transcriptional regulator [putative MarR-family repressor]
ATGGGTGATCGCCAGCAAGCCGTCGATCGCGTCGACGTGATCATGAAGCAGGTCGCGCAG
GTCTCGACGGCGCCCGACCTGACGTCCAAGGAACTCTGCCAGCGGATTCAGCGCGTCGCC
CACCATCTGGAGACCCGGCTCCGCCGTGAACTGGCCGTCTTCGGCATCGAACCCTGGGAG
ATCGAGCTGCTCGCCTCCCTGCGCCGGGTCGGGCCGCCCCACCAGGTGACCGCCGGTTCG
CTCCAGGACATCATGCAGCTGACCACCGGCGCCGTCACCAAGCGCGTGGCCGCCCTGGAG
AAGAAGGGGTGGGTGCGCCGGGAGGTCGACGCCGGCGATCGCCGCCAGGTACTGGTCTGC
CTCACGGACGAAGGGGAGCAGCGGGCGCTCGAGGTCTTCGCCACCAAGACGGAGACGGAG
GCGCGGGTGCTGTCCGCCCTCGACCTCGACACCCAGCGGCGGCTCAACGACGATCTGCGC
ACGCTTCTGATCGACCTGGAGGGAGCGGTCCGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [29-168]  PS50995
PS50995   HTH_MARR_2
 [93-108]  3.89999861795218e-05 PR00598 [112-128]  3.89999861795218e-05 PR00598
PR00598   HTHMARR
 [49-152]  2.30000440726534e-20 SM00347
SM00347   HTH_MARR
 [60-117]  2.8e-11 PF01047
PF01047   MarR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [16-164]  4.5e-30 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR023187 Transcriptional regulator MarR-type, conserved site (Conserved_site)
 [91-125]  PS01117
PS01117   HTH_MARR_1
SignalP No significant hit
TMHMM No significant hit