close all open/close all

CDS information : Ovied_00220


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction22,849 / 23,652 / + [in whole cluster]
22,849 / 23,652 / + [in contig]
Location22849..23652 [in whole cluster]
22849..23652 [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative 3-oxoacyl-[acyl-carrier-protein] reductase
putative beta-ketoacyl-acyl carrier protein reductase
Product (GenBank)putative 3-keto-acyl carrier protein reductase
GenefabG
Gene (GenBank)
EC number1.1.1.100
Keyword
Note
  • It is supposed that this ORF is not involved in oviedomycin biosynthesis.
Note (GenBank)
  • ORF5; FabG homologue
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)
Related Reference
ACC
A5HIF6
PmId
[18691538] Comparative effect of overexpressed phaJ and fabG genes supplementing (R)-3-hydroxyalkanoate monomer units on biosynthesis of mcl-polyhydroxyalkanoate in Pseudomonas putida KCTC1639. (J Biosci Bioeng. , 2008)
ACC
O54438
PmId
[10464226] Characterization of a Pseudomonas aeruginosa fatty acid biosynthetic gene cluster: purification of acyl carrier protein (ACP) and malonyl-coenzyme A:ACP transacylase (FabD). (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative 3-oxoacyl-[acyl-carrier-protein] reductase [putative 3-keto-acyl carrier protein reductase]
MTRSVSASGPLQGRIALVTGGSRGIGAATATTLAGLGADVVLTYRSSLDEAKAVAAACEE
KGVKATVLRADLDAADGAEELVTAVRERVDHLDVVVSNACASYPRVPLAGMDPTALGDKV
RNDVVLLHRLTTAFVPAMRERGYGRLVVISSGSSWGPTAPGLAAHGVTKAALEGYVRYAA
DEFGAGGVTVNGLALGFVLTDASSVVPQPARDALANATPAGRLGTPQDIADAVSLLARPE
SEWINGATLPVTGGLNYPLNLSRVRGH
selected fasta
>putative 3-oxoacyl-[acyl-carrier-protein] reductase [putative 3-keto-acyl carrier protein reductase]
ATGACTCGTAGCGTCTCCGCATCCGGCCCGCTTCAGGGCAGGATCGCGCTGGTGACAGGC
GGTAGCCGGGGGATCGGGGCCGCGACGGCCACCACCCTCGCCGGGCTCGGGGCCGACGTC
GTGCTCACATACCGAAGCTCGCTGGACGAGGCCAAGGCCGTGGCGGCCGCGTGCGAGGAA
AAAGGTGTAAAGGCCACGGTGCTCAGGGCCGACCTGGACGCGGCCGACGGCGCCGAGGAA
CTGGTCACCGCCGTGCGGGAACGGGTGGACCACCTCGACGTCGTCGTCAGCAACGCCTGC
GCCTCGTACCCGCGCGTGCCGCTGGCCGGCATGGACCCGACCGCGCTCGGCGACAAGGTC
CGCAACGACGTCGTCCTGCTGCACCGGCTCACCACCGCCTTCGTGCCCGCGATGCGGGAG
CGGGGGTACGGCCGGCTCGTCGTCATCTCCAGCGGCTCGTCCTGGGGCCCGACCGCGCCC
GGCCTCGCCGCGCACGGAGTGACGAAGGCCGCGCTGGAGGGCTACGTCCGGTACGCGGCC
GACGAGTTCGGCGCCGGTGGCGTGACCGTCAACGGCCTCGCCCTGGGCTTCGTCCTCACC
GACGCCTCCTCGGTGGTCCCGCAGCCGGCGCGCGACGCGCTGGCCAACGCCACGCCGGCC
GGGCGGCTCGGCACCCCGCAGGACATCGCCGACGCCGTGTCCCTGCTGGCGCGCCCCGAG
TCGGAGTGGATCAACGGGGCGACCCTCCCCGTGACCGGCGGCCTCAACTACCCGCTGAAC
CTGTCCCGCGTCCGCGGCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [15-32]  1.10000150671642e-28 PR00081 [90-101]  1.10000150671642e-28 PR00081 [138-154]  1.10000150671642e-28 PR00081 [165-184]  1.10000150671642e-28 PR00081 [186-203]  1.10000150671642e-28 PR00081 [219-239]  1.10000150671642e-28 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [11-256]  9.3000000000001e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-38]  0.563 Signal
Eukaryota   
TMHMM No significant hit