close all open/close all

CDS information : Ovied_00230


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction23,903 / 24,418 / + [in whole cluster]
23,903 / 24,418 / + [in contig]
Location23903..24418 [in whole cluster]
23903..24418 [in contig]
TypeCDS
Length516 bp (171 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in oviedomycin biosynthesis.
Note (GenBank)
  • ORF6
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MQRSSSEAAAQAVPPTSDSGGSGPRDLRRPGPAGDRPPARWAHRPVIAFRIVSVLFTVNT
LVQAALAGLFVNGDVGLLTAHDVNAHVLTMMLVAETAAATVAWRARANRVWPTVLGAALL
VLIVVQQIAGYSRNLLLHIPLGVALFGGACTMTVWAFTLTLPVRTLKALHR
selected fasta
>hypothetical protein [hypothetical protein]
ATGCAGCGATCCTCCTCAGAAGCCGCGGCGCAGGCCGTGCCCCCCACCTCCGACTCGGGC
GGATCCGGTCCCCGGGACTTACGGCGTCCCGGCCCGGCCGGTGACCGGCCACCCGCCCGC
TGGGCGCACCGGCCGGTGATCGCCTTCCGGATCGTCTCCGTGCTGTTCACCGTCAACACC
CTCGTCCAGGCCGCGCTGGCCGGGCTGTTCGTCAACGGCGACGTGGGACTGCTCACCGCC
CACGACGTCAACGCGCACGTTCTCACGATGATGCTCGTGGCGGAGACGGCAGCCGCCACC
GTCGCCTGGAGGGCGCGCGCGAACCGGGTCTGGCCCACGGTCCTCGGCGCCGCCCTCCTC
GTGCTGATCGTCGTTCAGCAGATCGCCGGGTACTCGCGGAACCTGCTGCTGCACATCCCG
CTCGGTGTCGCCCTGTTCGGCGGCGCGTGCACGATGACGGTCTGGGCGTTCACCCTCACC
CTGCCCGTCCGGACGCTCAAGGCGCTGCACCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [49-71]  Transmembrane (i-o) [86-103]  Transmembrane (o-i) [110-129]  Transmembrane (i-o) [139-161]  Transmembrane (o-i)
Transmembrane 4