close all open/close all
Ovied_00230 Ovied_00230   last last

CDS information : Ovied_00240


close this sectionLocation

Organism
StrainATCC 11891
Entry nameOviedomycin
Contig
Start / Stop / Direction24,415 / 24,720 / + [in whole cluster]
24,415 / 24,720 / + [in contig]
Location24415..24720 [in whole cluster]
24415..24720 [in contig]
TypeCDS
Length306 bp (101 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in oviedomycin biosynthesis.
Note (GenBank)
  • ORF7
Reference
ACC
PmId
[15368568] Genetic organization of the biosynthetic gene cluster for the antitumor angucycline oviedomycin in Streptomyces antibioticus ATCC 11891. (Chembiochem. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [hypothetical protein]
MTAPVPAPVPAPSRRGFLRLAAGGAGAVALGGLAGCGTDRPSTGVLLASDPEVELPRPFT
LPLTVPAVAKPTHGTDVPGTDVYEVTQRRASVEILPGTRTEI
selected fasta
>hypothetical protein(fragment) [hypothetical protein]
ATGACGGCGCCCGTCCCTGCCCCGGTACCCGCTCCCTCTCGCCGCGGCTTCCTTCGCCTG
GCGGCGGGCGGCGCCGGCGCGGTCGCGCTCGGCGGGCTGGCCGGCTGCGGCACGGACCGC
CCCTCGACCGGCGTCCTGCTCGCCAGCGACCCCGAGGTGGAACTGCCGCGCCCGTTCACG
CTGCCGCTGACCGTGCCCGCCGTGGCGAAGCCCACGCACGGCACGGACGTACCCGGCACG
GACGTGTACGAGGTGACCCAGCGGCGCGCCTCCGTGGAGATCCTCCCCGGCACCCGCACC
GAGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-48]  PS51318
PS51318   TAT
SignalP
 [1-27]  0.519 Signal
Bacteria, Gram-negative   
 [1-27]  0.597 Signal
Bacteria, Gram-positive   
 [1-35]  0.957 Signal
Eukaryota   
TMHMM No significant hit
Ovied_00230 Ovied_00230   last last