close all open/close all
first first   Oxtet_00020 Oxtet_00020

CDS information : Oxtet_00010


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction134 / 625 / + [in whole cluster]
134 / 625 / + [in contig]
Location134..625 [in whole cluster]
134..625 [in contig]
TypeCDS
Length492 bp (163 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductMarR family transcriptional repressor
Product (GenBank)OxyTA1
GeneoxyTA1
otrR
Gene (GenBank)oxyTA1
EC number
Keyword
Note
Note (GenBank)
  • putative transcription regulation
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[27100123] Development of a Synthetic Oxytetracycline-Inducible Expression System for Streptomycetes Using de Novo Characterized Genetic Parts. (ACS Synth Biol. , 2016)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>MarR family transcriptional repressor [OxyTA1]
MDSSAPDLAALIEVTAEVFAVNGRLLREGDSLTAHAGLTSARWQVAGLLLSGPSTVARLA
RERGLRRQAVQQTVERLKAEGVVTTRPNPQDQRSPLVELTARGRQALDDLRPLERRWLEY
LAEDIPVEDMRVAIAVLSRLREKLDARPATEFGTGAGSGRQSA
selected fasta
>MarR family transcriptional repressor [OxyTA1]
ATGGATTCCTCAGCCCCTGACCTGGCCGCTCTGATCGAGGTGACCGCCGAGGTCTTCGCG
GTCAACGGCCGCCTGCTCCGCGAAGGCGACAGCCTCACCGCCCACGCGGGGCTGACCTCG
GCGCGCTGGCAGGTGGCCGGACTGCTGCTGAGCGGCCCCTCGACGGTCGCCCGCCTGGCC
CGCGAGCGGGGGCTGCGGCGGCAGGCGGTCCAGCAGACCGTCGAGCGGCTGAAGGCCGAG
GGCGTCGTCACGACCCGGCCCAACCCGCAGGACCAGCGCAGCCCCCTGGTCGAGCTCACC
GCACGCGGCCGGCAGGCGCTGGACGACCTGCGTCCCCTGGAACGGCGGTGGCTGGAGTAT
CTGGCCGAGGACATTCCGGTCGAGGACATGCGCGTGGCGATCGCGGTGCTGAGCCGCCTG
CGGGAGAAGCTGGACGCCCGTCCGGCGACGGAGTTCGGGACCGGGGCCGGGTCCGGGCGG
CAGTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [5-142]  PS50995
PS50995   HTH_MARR_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [14-144]  3.8e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit
first first   Oxtet_00020 Oxtet_00020