close all open/close all

CDS information : Oxtet_00020


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction770 / 2,047 / + [in whole cluster]
770 / 2,047 / + [in contig]
Location770..2047 [in whole cluster]
770..2047 [in contig]
TypeCDS
Length1,278 bp (425 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)OxyA
GeneoxyA
otcY1-1
Gene (GenBank)oxyA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ketosynthase; similar to OtcY1 of GenBank Accession Number CAA80985
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)

close this sectionPKS/NRPS Module

KS8..378

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [OxyA]
MSKIHDARRVVITGIGVVAPGDVGTKPFWEMLTAGRTATRPISSFDASPFRSQVAAECDF
DPAAEGLSQRQVRAWDRTMQFAYVAAREALADSGVTGEADPLRTGVMAGTACGMTMSLDR
EYAVVSDEGRLWQVDDAHGVPYLYDYFVPSSMAAEIAWLAEAEGPAGVVSAGCTSGIDVL
THAADLVRDGAAEVMVAGASDAAISPITVACFDAIKATTPRNDEPETASRPFDRTRNGFV
LGEGAAFFVLEEYAHARRRGARAYAEIAGYAGRCNAYSMTGLRSDGRELAEAVSRALDIA
RVDPSEVDYVNAHGSATKQNDLHETAAFKRSLGPHAYSVPISSIKSMIGHSLGAICALEV
AASALRIEHGVIPPTANLREPDPDCDLDYVPLVAREAEVSTVVSVASGFGGFQSAIVLTE
PGRQR
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [OxyA]
ATGTCCAAGATCCATGACGCGCGACGCGTCGTAATCACAGGGATCGGCGTGGTGGCTCCG
GGAGACGTGGGCACCAAACCGTTCTGGGAGATGCTCACCGCGGGCCGTACCGCCACCCGC
CCGATCTCGTCCTTCGACGCCTCGCCCTTCCGCTCCCAGGTGGCGGCGGAGTGCGACTTC
GACCCGGCGGCGGAGGGGCTGAGCCAGCGGCAGGTCCGCGCCTGGGACCGCACCATGCAG
TTCGCTTACGTGGCCGCGCGGGAGGCGCTGGCGGACAGCGGTGTGACGGGCGAGGCGGAC
CCGCTGCGCACCGGCGTCATGGCCGGCACCGCCTGCGGCATGACGATGAGCCTGGACCGC
GAGTACGCGGTGGTCAGCGACGAGGGCCGGCTGTGGCAGGTGGACGACGCCCATGGGGTG
CCGTACCTCTACGACTACTTCGTGCCCTCGTCGATGGCGGCCGAGATCGCCTGGCTGGCG
GAGGCGGAGGGCCCGGCCGGGGTGGTCTCGGCCGGCTGCACCTCCGGCATCGACGTGCTC
ACCCACGCGGCGGACCTGGTACGCGACGGCGCGGCCGAGGTGATGGTGGCCGGGGCATCG
GACGCCGCCATCTCCCCCATCACGGTGGCGTGCTTCGACGCGATCAAGGCCACCACGCCG
CGCAACGACGAGCCGGAGACGGCGTCCCGTCCGTTCGACCGCACCCGCAACGGCTTCGTG
CTGGGCGAGGGGGCGGCGTTCTTCGTCCTGGAGGAGTACGCGCACGCCAGGCGGCGGGGG
GCCCGCGCGTACGCGGAGATCGCCGGGTACGCCGGGCGGTGCAACGCGTACAGCATGACC
GGGCTGCGCTCGGACGGGCGGGAGCTGGCCGAGGCGGTGAGCCGCGCGCTCGACATCGCG
CGCGTCGATCCGTCGGAGGTGGACTACGTCAACGCCCACGGTTCGGCGACCAAGCAGAAC
GATCTCCATGAGACGGCGGCGTTCAAGCGGAGCCTGGGTCCGCACGCCTACTCGGTCCCG
ATCAGCTCCATCAAATCGATGATCGGCCACTCGCTCGGTGCCATCTGCGCGCTGGAGGTC
GCGGCGAGCGCGCTGAGGATCGAGCACGGGGTGATCCCACCCACCGCGAACCTGCGGGAG
CCGGACCCCGACTGCGACCTGGACTATGTGCCGCTGGTCGCCAGGGAGGCCGAGGTGTCC
ACCGTGGTGTCCGTGGCCAGCGGATTCGGCGGCTTCCAGAGCGCGATCGTGCTCACCGAG
CCGGGGAGGCAGCGATGA
KS8..378
KS22..1134

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [8-255]  1.3e-58 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [264-378]  2.3e-35 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [6-269]  3.4e-58 G3DSA:3.40.47.10 [274-420]  4.4e-48 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [7-261]  5.2e-61 SSF53901 [223-421]  1.5e-62 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [164-180]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [10-417]  3.5e-10 SM00825
SM00825   Beta-ketoacyl synthase
SignalP No significant hit
TMHMM No significant hit