close all open/close all

CDS information : Oxtet_00030


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction2,044 / 3,312 / + [in whole cluster]
2,044 / 3,312 / + [in contig]
Location2044..3312 [in whole cluster]
2044..3312 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)OxyB
GeneoxyB
otcY1-2
Gene (GenBank)oxyB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • chain length factor/ketosynthase B; similar to OtcY2 of GenBank Accession Number AAA03333
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)

close this sectionPKS/NRPS Module

CLF23..379

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [OxyB]
MTGQLAPAPETGTGRPGGSVRPVVTGLGVVAPNGLGTERYWAATLRGDSGIGRITRFDPS
GYTSSLAGEIADFDPARLPNRLLPQTDLMTRLALVAAEEALDDAGADPRTMPDFAAGVVT
AASAGGFDFGQRELEALWSKGGAHVSAYQSFAWFYPVNSGQISIRHDMRGPGGALVAEQA
GGLDAVAKARRHVRDGTPLMLTGGVDGSLCPWGWLCMTRSGALTTRTDPRRAYLPFSPDA
SGYVPGEGGALLVLEDPRAAAERGAPQVYGRIAGYAATFDPRPGSGREPGLRRALRLALD
DAGIGPADVDVVFADAMGVPALDAVETQVLAAEFGPRGVPVTAPKTMTGRLLAGGASLDL
AAALLSLRDQVVPPTVHVDGGEIPDSLDLVTGAPRPARLRHALVLARGHGGFNSAMVVSG
RD
selected fasta
>polyketide synthase chain length factor subunit [OxyB]
ATGACCGGCCAGCTCGCCCCCGCTCCCGAAACCGGCACCGGCCGCCCCGGCGGCAGCGTC
CGGCCGGTGGTCACCGGCCTCGGTGTGGTCGCGCCCAACGGCCTGGGCACCGAGCGGTAC
TGGGCCGCGACGCTGCGCGGCGACAGCGGCATCGGCCGGATCACCCGGTTCGACCCGTCC
GGCTACACCTCCTCGCTGGCCGGGGAGATCGCGGACTTCGACCCCGCGCGGCTGCCGAAC
CGGCTGCTGCCGCAGACCGACCTGATGACCCGGCTCGCGCTGGTCGCGGCCGAGGAGGCG
CTGGACGACGCGGGCGCCGACCCGCGCACGATGCCCGACTTCGCCGCCGGGGTGGTCACC
GCCGCGTCGGCGGGCGGCTTCGACTTCGGCCAGCGGGAGCTGGAGGCCCTGTGGAGCAAG
GGTGGCGCGCACGTCAGCGCGTATCAGTCCTTCGCCTGGTTCTATCCGGTCAACTCCGGT
CAGATCTCGATCCGGCACGATATGCGGGGCCCCGGCGGCGCGCTGGTGGCCGAGCAGGCC
GGCGGGCTGGACGCGGTGGCCAAGGCGCGCCGCCACGTACGGGACGGGACGCCGCTGATG
CTCACCGGCGGTGTGGACGGTTCGCTGTGCCCGTGGGGCTGGCTGTGCATGACCCGTTCC
GGCGCGCTGACCACCCGGACCGATCCGCGCCGCGCGTACCTGCCCTTCTCCCCCGACGCC
TCCGGATACGTGCCGGGTGAGGGCGGGGCGCTGCTGGTCCTGGAGGACCCTCGGGCCGCC
GCGGAGCGGGGTGCCCCGCAGGTCTACGGGCGGATCGCCGGGTACGCGGCCACCTTCGAC
CCCCGTCCGGGCTCCGGCCGGGAACCGGGTCTGCGCAGAGCGCTCCGGCTGGCGCTGGAC
GACGCCGGGATCGGACCGGCGGACGTGGACGTGGTCTTCGCCGACGCGATGGGCGTACCG
GCGCTCGACGCGGTGGAAACACAGGTGCTGGCCGCCGAGTTCGGCCCGCGCGGGGTGCCG
GTGACGGCTCCCAAGACGATGACGGGACGGCTGCTGGCCGGCGGCGCCTCTCTGGACCTG
GCGGCGGCGCTGCTGTCGCTGCGCGACCAGGTCGTACCGCCGACGGTGCACGTGGACGGC
GGCGAGATCCCGGACTCGCTGGACCTGGTGACCGGCGCTCCCCGGCCGGCGCGCCTGCGG
CACGCGCTGGTGCTGGCCCGCGGTCACGGCGGGTTCAACTCCGCGATGGTGGTCAGCGGC
CGGGACTGA
CLF23..379
CLF67..1137

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [23-256]  1.40000000000001e-51 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [269-379]  9e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [23-274]  1.5e-50 G3DSA:3.40.47.10 [286-419]  2.4e-35 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [19-265]  3.99998544139406e-58 SSF53901 [228-418]  5.79999653854781e-47 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit