close all open/close all

CDS information : Oxtet_00040


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction3,388 / 3,675 / + [in whole cluster]
3,388 / 3,675 / + [in contig]
Location3388..3675 [in whole cluster]
3388..3675 [in contig]
TypeCDS
Length288 bp (95 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)OxyC
GeneoxyC
otcY1-3
Gene (GenBank)oxyC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • acyl carrier protein; similar to OtcY3 of GenBank Accession Number AAA03334
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [OxyC]
MTLLTLSDLLTLLRECAGEEESIDLGGDVEDVAFDALGYDSLALLNTVGRIERDYGVQLG
DDAVEKATTPRALIEMTNASLTGASPSAGGAARDK
selected fasta
>polyketide synthase acyl carrier protein subunit [OxyC]
ATGACCCTGCTCACCCTCTCCGACCTGCTCACCCTGCTGCGCGAGTGCGCGGGCGAGGAG
GAATCCATCGACCTGGGAGGGGACGTCGAGGACGTCGCCTTCGACGCCCTCGGCTACGAC
TCGCTGGCGCTGCTGAACACCGTGGGACGCATCGAGCGCGACTACGGGGTCCAGCTCGGG
GACGACGCGGTGGAGAAGGCGACCACGCCGCGCGCCCTGATCGAGATGACCAACGCGTCG
CTCACCGGCGCGTCCCCGTCCGCGGGTGGCGCCGCGCGGGACAAGTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [36-51]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [9-76]  1.1e-07 PF00550
PF00550   PP-binding
 [1-95]  2e-16 SSF47336
SSF47336   ACP-like
 [5-78]  14.481 PS50075
PS50075   ACP_DOMAIN
 [8-80]  6.8e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
SignalP
 [1-18]  0.658 Signal
Eukaryota   
TMHMM No significant hit