close all open/close all

CDS information : Oxtet_00050


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction3,686 / 5,524 / + [in whole cluster]
3,686 / 5,524 / + [in contig]
Location3686..5524 [in whole cluster]
3686..5524 [in contig]
TypeCDS
Length1,839 bp (612 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productamide synthetase
Product (GenBank)OxyD
GeneoxyD
otcY1-4
Gene (GenBank)oxyD
EC number
Keyword
Note
Note (GenBank)
  • amidotransferase involved in malonamyl starter unit biosynthesis
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[17125237] Heterologous biosynthesis of amidated polyketides with novel cyclization regioselectivity from oxytetracycline polyketide synthase. (J Nat Prod. , 2006)
[17631493] Investigation of early tailoring reactions in the oxytetracycline biosynthetic pathway. (J Biol Chem. , 2007)
[21622525] Genetic characterization of enzymes involved in the priming steps of oxytetracycline biosynthesis in Streptomyces rimosus. (Microbiology. , 2011)
Related Reference
ACC
Q2MGB4
NITE
Fred_00250
PmId
[20926388] Characterization of FdmV as an amide synthetase for fredericamycin A biosynthesis in Streptomyces griseus ATCC 43944. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>amide synthetase [OxyD]
MCGIAGWIDFERNLAQERATAWAMTDTMACRGPDDAGLWTGGHAALGHRRLAVIDPAHGR
QPMHSTLPDGTSHVITFSGEIYNFRELRVELESQGHRFRTHCDTEVVLHGYTRWGRELVD
RLNGMYAFAVWDEARQELLLVRDRMGVKPLYYHPTATGVLFGSEPKAVLAHPSLRRRVTA
EGLCEVLDMVKTPGRTVFSGMREVLPGEMVTVGRSGVARRRYWTLQAREHTDDLETTIAT
VRGLLTDRVRRQLVSDVPLCTLLSGGLDSSAVTALAARAGDGPVRTFSVDFSGAGTRFQP
DAVRGNTDAPYVQEMVRHVAADHTEVVLDSADLAAPEVRAAVLGATDLPPAFWGDMWPSL
YLFFRQVRQHCTVALSGEAADELFGGYRWFHRTAAIDAGTFPWLTAGSARYFGGRGLFDR
KLLDKLDLPGYQRDRYAEARKEVPVLPGEDAREAELRRVTYLNLTRFVQTLLDRKDRMSM
ATGLEVRVPFCDHRLVDYVFNVPWAMKSFDGREKSLLRAAVRDLLPESVVTRVKTPYPAT
QDPVYERLLRDELAALLADSQAPVRELLDLGRARDLLRRPVGAVSQPYDRGSLELVLWMN
TWLAEYGVSLEL
selected fasta
>amide synthetase [OxyD]
ATGTGCGGAATCGCCGGCTGGATCGATTTCGAACGCAATCTGGCGCAGGAGCGGGCGACG
GCCTGGGCCATGACGGACACCATGGCCTGCCGGGGCCCGGACGACGCGGGCCTGTGGACC
GGTGGCCACGCGGCGCTCGGCCACCGCAGGCTGGCCGTCATCGACCCGGCGCACGGGCGG
CAGCCGATGCACAGCACGCTGCCGGACGGCACGAGCCACGTCATCACGTTCAGCGGGGAG
ATCTACAACTTCCGTGAACTGCGGGTCGAGCTGGAGTCCCAGGGGCACCGCTTCCGTACC
CACTGCGACACGGAGGTGGTGCTGCACGGCTACACCCGGTGGGGCCGGGAGCTGGTGGAC
CGGCTCAACGGCATGTACGCGTTCGCCGTGTGGGACGAGGCCCGGCAGGAACTGCTGCTG
GTCCGCGACCGGATGGGGGTCAAGCCGCTCTACTACCACCCCACCGCCACCGGTGTGCTG
TTCGGCTCCGAGCCGAAGGCCGTGCTCGCGCACCCCTCGCTGCGGCGGCGGGTGACGGCC
GAGGGCCTGTGCGAGGTGCTGGACATGGTCAAGACCCCCGGCCGGACCGTCTTCTCCGGT
ATGCGCGAGGTGCTGCCGGGCGAGATGGTCACCGTCGGGCGCTCCGGTGTGGCCCGCAGG
CGGTACTGGACGCTCCAGGCGCGGGAGCACACCGACGATCTGGAGACCACCATCGCCACG
GTGCGCGGCCTGCTGACGGACAGGGTGCGCCGGCAGCTGGTCTCCGATGTGCCGCTGTGC
ACCCTGCTCTCCGGCGGGCTGGACTCGTCGGCGGTGACGGCGCTGGCGGCGCGGGCGGGC
GACGGGCCGGTCCGTACGTTCTCGGTGGACTTCTCCGGCGCGGGCACCCGGTTCCAGCCG
GACGCCGTACGGGGCAACACGGACGCGCCGTACGTCCAGGAGATGGTGCGGCACGTGGCG
GCGGACCATACGGAAGTCGTGCTGGACAGCGCCGATCTCGCGGCACCCGAGGTGCGTGCC
GCCGTCCTGGGGGCCACCGACCTGCCCCCGGCGTTCTGGGGCGACATGTGGCCCTCGCTG
TACCTGTTCTTCCGGCAGGTGCGGCAGCACTGCACGGTGGCCCTGTCGGGCGAGGCGGCG
GACGAACTCTTCGGCGGTTACCGGTGGTTCCACCGGACGGCGGCCATCGACGCCGGTACG
TTCCCCTGGCTGACCGCCGGCTCGGCCCGGTACTTCGGCGGCCGGGGCCTGTTCGACCGC
AAGCTGCTGGACAAGCTCGACCTGCCGGGCTACCAGCGCGACCGGTACGCCGAGGCCCGT
AAGGAAGTCCCCGTCCTGCCCGGCGAGGACGCGCGGGAGGCGGAGCTGCGCCGGGTGACC
TACCTCAACCTCACCCGCTTCGTGCAGACCCTGCTGGACCGCAAGGACCGGATGAGCATG
GCGACCGGCCTGGAGGTGCGGGTGCCGTTCTGCGACCACCGGCTGGTCGACTACGTCTTC
AACGTGCCGTGGGCCATGAAGTCCTTCGACGGCAGGGAGAAGAGCCTGCTGCGGGCCGCG
GTGCGCGACCTGCTGCCGGAGTCGGTGGTCACCCGGGTCAAGACGCCCTACCCCGCCACA
CAGGACCCGGTCTACGAGCGGCTGTTGCGCGACGAACTGGCCGCGCTGCTGGCCGACAGC
CAGGCGCCGGTCCGCGAACTGCTCGACCTGGGTCGGGCGCGCGACCTGCTGCGGCGGCCG
GTCGGCGCCGTCAGCCAACCGTACGACCGCGGCAGTCTGGAGCTGGTCCTGTGGATGAAC
ACCTGGCTGGCGGAGTACGGCGTCAGCCTGGAGCTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000583 Class II glutamine amidotransferase domain (Domain)
 [48-170]  1.40000000000001e-46 PF13537
PF13537   GATase_7
IPR001962 Asparagine synthase (Domain)
 [241-534]  6.10000000000004e-68 PF00733
PF00733   Asn_synthase
IPR006426 Asparagine synthase, glutamine-hydrolyzing (Family)
 [1-611]  PIRSF001589
PIRSF001589   Asn_synthetase_glu-h
 [2-537]  TIGR01536
TIGR01536   Asn_synth_AEB
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [224-398]  2.79999999999994e-76 G3DSA:3.40.50.620 [460-603]  2.79999999999994e-76 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
IPR017932 Glutamine amidotransferase type 2 domain (Domain)
 [2-215]  PS51278
PS51278   GATASE_TYPE_2
SignalP No significant hit
TMHMM No significant hit