close all open/close all

CDS information : Oxtet_00060


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction5,521 / 6,777 / + [in whole cluster]
5,521 / 6,777 / + [in contig]
Location5521..6777 [in whole cluster]
5521..6777 [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
ProductC-4 hydroxylase
Product (GenBank)OxyE
GeneoxyE
otcY1-5
Gene (GenBank)oxyE
EC number
Keyword
  • ancillary
Note
Note (GenBank)
  • putative oxygenase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)
[19472250] Identification of OxyE as an ancillary oxygenase during tetracycline biosynthesis. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>C-4 hydroxylase [OxyE]
MTGHPRPPADGAHTDVCVVGGGPAGLTLALLMLRSGARVTLVERSRSLDRAYRGEILQPG
GQALLDALGVLEGARRRGCHEHDGFRLEERGRTLINGDYRRLPGPYNCLLSLPQQHLLTD
LLERCRAHPRFTCLTGTKVNGLVEEGGVVRGVVCGGGADGLVVRADCVVGADGRYSTVRK
LAGIPYDRIELFDQDVLWCKLTAPATRTVRIFRAGGNPVLAYTSFPDCVQLGWTLPHKGY
QALAERGFAHVKERIRAAVPEYADTVDQQLNSFKDVSLLDVFAGSARRWARDGLLLIGDS
AHTHSPIGAQGINLAIQDAVAAHPVLCEGLRRRDLSERFLDAVAARRRPETERATRVQVM
QSRMMLSTGRVSAAVRPKAAMLVSRTPAYRSVLRRIAYGDQTLRVRSDLFEEGEPATV
selected fasta
>C-4 hydroxylase [OxyE]
ATGACCGGCCACCCGCGGCCGCCGGCCGACGGCGCGCACACCGATGTGTGCGTCGTCGGC
GGCGGCCCGGCCGGGCTGACCCTGGCGCTGCTGATGCTGCGCTCGGGGGCGCGGGTGACG
CTGGTCGAGCGCAGCCGCTCACTGGACCGCGCCTACCGGGGCGAGATCCTCCAGCCGGGC
GGGCAGGCCCTGCTCGACGCGCTCGGCGTCCTGGAGGGTGCCCGGCGGCGCGGCTGCCAC
GAGCACGACGGTTTCCGGCTGGAGGAGCGCGGCAGGACCCTGATCAACGGGGATTACCGG
CGGCTGCCCGGCCCGTACAACTGTCTGCTCAGCCTGCCGCAGCAGCATCTGCTGACCGAT
CTGCTGGAGCGCTGCCGGGCCCACCCGCGCTTCACCTGCCTGACCGGCACCAAGGTCAAC
GGGCTGGTGGAGGAGGGCGGCGTGGTGCGCGGTGTGGTGTGCGGCGGCGGGGCGGACGGG
CTCGTGGTGCGCGCGGACTGCGTCGTCGGTGCGGACGGGCGGTATTCGACGGTCCGCAAG
CTGGCCGGCATTCCGTACGACCGCATCGAGCTGTTCGACCAGGACGTGCTGTGGTGCAAG
CTCACCGCGCCCGCCACCCGTACGGTGCGGATCTTCCGGGCCGGCGGCAACCCGGTGCTG
GCCTACACGTCCTTCCCCGACTGCGTACAGCTCGGCTGGACGCTGCCGCACAAGGGCTAC
CAGGCGCTGGCCGAGCGGGGGTTCGCGCACGTCAAGGAGCGTATCCGGGCAGCCGTGCCC
GAGTACGCGGACACGGTGGACCAGCAGCTGAACAGCTTCAAGGACGTGTCTCTGCTGGAT
GTGTTCGCCGGCTCCGCACGGCGGTGGGCGCGCGACGGGCTGCTGCTCATCGGCGACAGC
GCGCACACCCACAGCCCGATCGGGGCCCAGGGCATCAACCTCGCCATCCAGGACGCGGTC
GCCGCGCACCCGGTGCTGTGCGAGGGCCTGCGGCGACGGGACCTGAGCGAGCGGTTCCTC
GACGCGGTCGCGGCGCGGCGCCGTCCGGAGACCGAGCGGGCGACCCGCGTCCAGGTGATG
CAGAGCCGGATGATGCTGTCGACCGGACGCGTTTCGGCGGCCGTCCGCCCGAAGGCGGCG
ATGCTGGTCTCGCGTACCCCGGCCTACCGCTCCGTCCTGCGGCGCATCGCCTACGGCGAC
CAGACACTGCGGGTCCGCTCCGACCTGTTCGAGGAGGGCGAGCCCGCCACCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [14-355]  4.5e-43 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [15-37]  1e-22 PR00420 [164-179]  1e-22 PR00420 [291-306]  1e-22 PR00420 [306-322]  1e-22 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit