close all open/close all

CDS information : Oxtet_00070


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction7,846 / 6,809 / - [in whole cluster]
7,846 / 6,809 / - [in contig]
Locationcomplement(6809..7846) [in whole cluster]
complement(6809..7846) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-6 C-methyltransferase
Product (GenBank)OxyF
GeneoxyF
otcY2-5
Gene (GenBank)oxyF
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • putative C6-methyltransferase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[17631493] Investigation of early tailoring reactions in the oxytetracycline biosynthetic pathway. (J Biol Chem. , 2007)

close this sectionSequence

selected fasta
>C-6 C-methyltransferase [OxyF]
MTSTSPTALPPAVMRLRELALSAACAAAVRAAASLGVADALGDEPADAGTLAKAVRADAD
ALERLLRALAAYDVFSELPDGRFEHTDASRLLREDAPRGLRYSALWATEPWTWALWPHLA
DAVRTGREEFTALYGTEFFDWLHTAEARESAEVFDKAMTQSSVLSAKAIAEVLDLDGVGA
MVDIAGGQGMVLATLLEKYPALRGTLFDLPKVVADADPRLREGGALAGRAQLVGGDCRQS
VPEGADLYLLKNILEWDDESTVRTLRNVAKSAPAGARVVVVENLVDGSPETRFTTAMDLM
LLLNVGGKKHTKAGLSALVEQAGLQLEEVRAVNSYLHMFVSTVPA
selected fasta
>C-6 C-methyltransferase [OxyF]
GTGACCAGCACCTCTCCCACGGCGCTTCCCCCCGCCGTCATGCGGCTGCGCGAACTCGCC
CTGAGCGCCGCCTGTGCCGCCGCCGTCCGCGCCGCGGCGAGCCTGGGCGTCGCGGACGCC
CTCGGGGACGAACCCGCGGACGCCGGCACCCTCGCGAAGGCGGTGCGGGCCGACGCGGAC
GCGCTGGAGCGCCTGCTGCGCGCCCTCGCCGCGTACGACGTCTTCAGCGAACTCCCCGAC
GGCCGCTTCGAGCACACCGACGCCTCCCGGCTGCTGCGCGAGGACGCCCCGCGCGGCCTG
CGCTACTCGGCGCTGTGGGCGACCGAGCCGTGGACCTGGGCGCTGTGGCCGCACCTGGCG
GACGCCGTGCGCACCGGCCGGGAGGAGTTCACCGCGCTGTACGGCACCGAGTTCTTCGAC
TGGCTGCACACCGCCGAGGCCCGCGAGTCGGCCGAGGTGTTCGACAAGGCCATGACCCAG
TCCAGCGTGCTGTCGGCGAAGGCCATCGCCGAGGTGCTCGACCTGGACGGCGTCGGCGCC
ATGGTGGACATCGCCGGGGGCCAGGGCATGGTGCTCGCCACCCTGCTGGAGAAGTACCCG
GCGCTGCGCGGCACCCTCTTCGACCTGCCGAAGGTCGTCGCCGACGCCGACCCGCGGCTG
CGCGAGGGCGGCGCGCTCGCCGGGCGCGCGCAGCTGGTGGGCGGTGACTGCCGGCAGTCG
GTGCCGGAGGGTGCCGACCTGTATCTGCTGAAGAACATCCTGGAGTGGGACGACGAGAGC
ACGGTGCGCACCCTGCGCAACGTCGCCAAGTCGGCCCCCGCCGGGGCGCGCGTCGTGGTG
GTGGAGAACCTGGTCGACGGCAGTCCCGAGACCCGGTTCACCACCGCCATGGACCTGATG
CTGCTGCTCAACGTCGGCGGCAAGAAGCACACCAAGGCGGGGCTGAGCGCGCTGGTGGAG
CAGGCGGGGCTCCAGCTGGAGGAGGTACGCGCGGTCAACTCCTACCTGCACATGTTCGTG
AGCACGGTGCCCGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [81-319]  2.29999999999998e-50 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [15-89]  1.5e-14 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-338]  3.00000067992871e-14 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-40]  0.47 Signal
Bacteria, Gram-positive   
TMHMM No significant hit