close all open/close all

CDS information : Oxtet_00090


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction10,324 / 9,872 / - [in whole cluster]
10,324 / 9,872 / - [in contig]
Locationcomplement(9872..10324) [in whole cluster]
complement(9872..10324) [in contig]
TypeCDS
Length453 bp (150 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)OxyI
GeneoxyI
otcY2-2
Gene (GenBank)oxyI
EC number
Keyword
Note
Note (GenBank)
  • putative fourth ring cyclase; similar to MtmX from the mithramycin PKS
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[17631493] Investigation of early tailoring reactions in the oxytetracycline biosynthetic pathway. (J Biol Chem. , 2007)
Related Reference
ACC
Q9ZAT9
NITE
Adria_00050
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
ACC
Q2PA04
NITE
Stref_00110
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [OxyI]
MTAPEQPSGVPVDTALYQEIQHFYGRQMRCLDEARVEEWAGTFTEDGVFVANAHPEPSVG
RAAIAAGARKAAALLAEQGVQRRHWLGMLDADACDDGTVRARTYALIISTPRGGQAAVHL
STSCDDVLVREDGQLRVRHREVRRDDLRPE
selected fasta
>hypothetical protein [OxyI]
ATGACCGCCCCGGAACAGCCCTCGGGCGTCCCCGTGGACACCGCGCTCTACCAGGAGATC
CAGCACTTCTACGGACGCCAGATGCGCTGCCTGGACGAGGCGCGGGTCGAGGAGTGGGCC
GGCACCTTCACCGAGGACGGCGTCTTCGTCGCCAACGCCCACCCCGAGCCGTCCGTCGGG
CGGGCCGCCATCGCGGCCGGGGCCCGCAAGGCCGCCGCCCTGCTGGCCGAGCAGGGCGTC
CAGCGCCGCCACTGGCTCGGCATGCTGGACGCCGACGCCTGTGACGACGGCACCGTCCGC
GCCCGCACCTACGCCCTGATCATCAGCACGCCGCGCGGCGGCCAGGCCGCGGTGCACCTG
AGCACGAGCTGCGACGACGTGCTCGTACGGGAGGACGGCCAACTGCGCGTACGGCACCGC
GAGGTGCGCCGGGACGACCTGCGGCCCGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit