close all open/close all

CDS information : Oxtet_00100


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction10,593 / 11,384 / + [in whole cluster]
10,593 / 11,384 / + [in contig]
Location10593..11384 [in whole cluster]
10593..11384 [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productpolyketide C-9 ketoreductase
Product (GenBank)OxyJ
GeneoxyJ
otcY2-1
Gene (GenBank)oxyJ
EC number
Keyword
Note
Note (GenBank)
  • C9 ketoreductase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>polyketide C-9 ketoreductase [OxyJ]
MTTSATPRTALVTGGTSGIGLAVVKTLAARGLRVFLCARSRENVDAVVKELRDQGLQVAG
CEGDVRSRESVERVVRAAVDRFGPLSVLVNNAGRSGGGVTARIPDELWYDVIDTNLNSAF
LVTREALTTGGLERAGVDGRIISIASTGGKQGVPLGAPYSASKAGLIGFTKALAKELAPT
GVTVNAVCPGYVETPMAVRVRQAYAATWDTTEEDVLSRFNDKIPLGRYSTPEEVAALVGH
LAGDEAGSITAQALNVCGGLGIY
selected fasta
>polyketide C-9 ketoreductase [OxyJ]
ATGACTACCAGTGCCACGCCCAGGACCGCCCTGGTGACGGGCGGCACCAGCGGCATCGGG
CTCGCCGTGGTGAAGACGCTCGCCGCCCGCGGGCTGCGGGTGTTCCTGTGCGCCCGCAGC
CGCGAGAACGTCGACGCCGTGGTCAAGGAACTGCGCGACCAGGGGCTTCAGGTGGCCGGG
TGCGAGGGGGACGTGCGGTCCCGGGAGTCGGTGGAGCGGGTGGTGCGCGCCGCGGTCGAC
CGGTTCGGGCCGCTGAGCGTCCTGGTGAACAACGCGGGGCGCAGCGGCGGCGGAGTGACC
GCGCGCATCCCCGACGAGCTCTGGTACGACGTGATCGACACCAACCTCAACAGCGCCTTC
CTGGTCACCCGTGAGGCCCTGACCACCGGCGGGCTGGAGCGGGCGGGCGTCGACGGGCGG
ATCATCAGCATCGCCTCCACCGGCGGCAAGCAGGGCGTTCCGCTGGGCGCCCCCTACTCG
GCCTCGAAGGCGGGCCTGATCGGTTTCACCAAGGCGCTGGCCAAGGAGCTGGCCCCCACG
GGGGTCACCGTCAACGCCGTGTGCCCGGGGTACGTGGAGACGCCGATGGCCGTCCGCGTA
CGGCAGGCGTACGCGGCCACCTGGGACACCACCGAGGAGGACGTGCTGTCCCGCTTCAAC
GACAAGATCCCGCTGGGGCGCTACTCCACACCCGAGGAGGTGGCCGCCCTGGTCGGCCAC
CTGGCGGGCGACGAGGCCGGGTCCATCACCGCGCAGGCCCTCAACGTCTGCGGCGGGCTG
GGCATTTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [83-94]  8.60000664726925e-14 PR00080 [139-147]  8.60000664726925e-14 PR00080 [159-178]  8.60000664726925e-14 PR00080
PR00080   SDRFAMILY
 [1-257]  3.0999994589937e-15 PIRSF000126
PIRSF000126   11-beta-HSD1
 [9-177]  8.39999999999997e-38 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  1e-43 PR00081 [83-94]  1e-43 PR00081 [133-149]  1e-43 PR00081 [159-178]  1e-43 PR00081 [180-197]  1e-43 PR00081 [224-244]  1e-43 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-260]  2.99999999999998e-82 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [146-174]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit