close all open/close all

CDS information : Oxtet_00110


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction11,443 / 12,396 / + [in whole cluster]
11,443 / 12,396 / + [in contig]
Location11443..12396 [in whole cluster]
11443..12396 [in contig]
TypeCDS
Length954 bp (317 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)OxyK
GeneoxyK
otcD1
Gene (GenBank)oxyK
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • putative aromatase; similar to OtcD1 of GenBank Accession Number AAD10031
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[17125237] Heterologous biosynthesis of amidated polyketides with novel cyclization regioselectivity from oxytetracycline polyketide synthase. (J Nat Prod. , 2006)
[17631493] Investigation of early tailoring reactions in the oxytetracycline biosynthetic pathway. (J Biol Chem. , 2007)
Related Reference
ACC
Q9ZG83
PmId
[10551844] Disruption of an aromatase/cyclase from the oxytetracycline gene cluster of Streptomyces rimosus results in production of novel polyketides with shorter chain lengths. (J Biol Chem. , 1999)
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)

close this sectionSequence

selected fasta
>cyclase/dehydratase [OxyK]
MPAPTSHRAVHRTEIDAPADRVYALIRDAAEWPRHFTPTVHVERAELDARSERLRIWATA
NGEVKHWTSHRALDPEGQSVRFRQEVCSPPVAAMSGEWVLRDLPGGRCELTLHHTFAAVD
DRPEDVEWITTATDRNSRTELANIKALAEAAGSDAELLFSFEDSETVHAPAEAVYAFLAE
AGKWPDRLPHVSRLDLTEPSDGVQVMTMVTRANDGSEHTTESVRVCFPDELRIVYKQIGT
PPLMTLHTGEWSIRDTGDGLLVTSQHTIRINESAIPEILGADATAADARARVRAAVGGNS
AATLALAKRFAEAPHAA
selected fasta
>cyclase/dehydratase [OxyK]
ATGCCCGCACCCACATCCCACCGCGCCGTGCACCGCACGGAGATCGACGCCCCGGCCGAC
CGGGTGTACGCCCTGATCAGGGACGCCGCCGAGTGGCCCCGGCACTTCACCCCGACCGTC
CACGTCGAGCGCGCGGAGCTCGACGCCCGCAGCGAGCGGCTGCGGATCTGGGCCACCGCC
AACGGCGAGGTCAAGCACTGGACGTCGCACCGCGCCCTGGACCCCGAAGGGCAGAGCGTC
CGGTTCCGGCAGGAGGTGTGTTCGCCTCCGGTGGCCGCGATGAGCGGTGAATGGGTCCTC
CGGGACCTTCCGGGCGGGCGGTGCGAGCTGACGCTGCACCACACGTTCGCCGCGGTGGAC
GACCGCCCGGAGGACGTGGAGTGGATCACCACCGCGACCGACCGCAACAGCCGTACCGAG
CTGGCGAACATCAAGGCGCTGGCCGAGGCCGCGGGGTCCGACGCGGAGCTGCTGTTCTCG
TTCGAGGACTCCGAGACGGTGCACGCCCCGGCCGAGGCGGTGTACGCGTTCCTCGCGGAG
GCCGGGAAGTGGCCCGACCGGCTGCCGCACGTCTCCCGGCTCGACCTCACCGAGCCGTCC
GACGGCGTGCAGGTGATGACCATGGTCACCCGGGCCAACGACGGCTCGGAGCACACGACG
GAGTCGGTGCGGGTCTGCTTCCCCGACGAACTGCGCATCGTCTACAAGCAGATCGGCACC
CCGCCGCTGATGACCCTGCACACCGGTGAGTGGTCGATACGGGACACCGGGGACGGGCTG
CTCGTCACCTCCCAGCACACCATCCGGATCAACGAATCCGCCATCCCGGAGATCCTCGGC
GCGGACGCCACGGCGGCCGACGCGCGGGCCCGGGTGCGCGCGGCGGTCGGCGGCAACAGC
GCGGCCACCCTGGCCCTCGCCAAGCGCTTCGCGGAGGCCCCGCATGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [8-149]  8.9e-13 PF10604 [160-309]  5.29999999999999e-11 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [9-149]  6.50000000000001e-16 G3DSA:3.30.530.20 [161-299]  6.50000000000001e-16 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit