close all open/close all

CDS information : Oxtet_00120


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction12,386 / 14,059 / + [in whole cluster]
12,386 / 14,059 / + [in contig]
Location12386..14059 [in whole cluster]
12386..14059 [in contig]
TypeCDS
Length1,674 bp (557 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
ProductC-4/C-12a hydroxylase
Product (GenBank)OxyL
GeneoxyL
otcD2
Gene (GenBank)oxyL
EC number
Keyword
Note
Note (GenBank)
  • putative oxygenase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>C-4/C-12a hydroxylase [OxyL]
MPPEADGPQVLIAGAGPVGLTLAHELTRRRVRVRVIDRADGPATTSRALAVHPRTLEACH
QMGLADALVARGRPVVHFTVHLRGRQLIRFDTNYGRLPTAYPFSLMLDQVRTEEILRERL
AGLGVGIEWGVELADCAPCGDRVNAELRRDGRSEQVTVPWLVGADGSRSTVRERLGLRLV
GDATQTWLNADVVLDADLSRDSNHLVHTGSGTVLLVPFPDPGKWRAVDTGYAGQGADPET
VRRRLAGSLARGLGRPVAVSEPTWVSVFRVQQRMITAMRSGRCFVAGDAAHVHSPASGQG
MNTGMQDAYNLAWKLADVVRGHAREELLDTYAAERIPVGGRLLSSTRTATALVALRNAVA
PVAMPVGLSFLKAVRPLKRRVEHRIMAGMSGLALHYADSPLTYGTGDGAAGVHPGHLVAC
TEQDVARHPGLRALRQALTDPRWLLLLFADDGGAAELALRYGRAVQIRTVIPHEDEDGPA
LADPDDALRQTLGVPPGGWALIRPDGYLAAKGQRSGTTTLTARLQALHLLPEDTAPGAGD
SAGRPAPDGTRRGVTTE
selected fasta
>C-4/C-12a hydroxylase [OxyL]
ATGCCGCCTGAGGCGGACGGCCCGCAGGTGCTGATCGCCGGCGCCGGGCCCGTCGGCCTG
ACCCTGGCGCACGAGCTGACCCGCCGGCGCGTCCGCGTCCGGGTCATCGACCGGGCGGAC
GGCCCGGCGACCACCAGCCGGGCGCTGGCCGTGCATCCGCGCACCCTGGAGGCGTGCCAC
CAGATGGGCCTGGCGGACGCCCTGGTGGCGCGGGGCCGGCCGGTCGTCCACTTCACCGTG
CACCTGCGCGGCCGGCAGCTGATCCGCTTCGACACCAACTACGGCAGGCTGCCCACGGCG
TACCCGTTCAGCCTGATGCTCGACCAGGTCCGTACGGAGGAGATCCTGCGCGAGCGCCTG
GCCGGGCTGGGCGTCGGGATCGAGTGGGGCGTGGAACTGGCGGACTGCGCGCCCTGCGGG
GACCGGGTCAACGCCGAACTGCGCCGTGACGGCCGCTCCGAACAGGTCACCGTGCCCTGG
CTGGTGGGCGCGGACGGCTCGCGCAGCACCGTACGCGAGCGGCTGGGGCTGCGGCTGGTC
GGCGACGCGACGCAGACCTGGCTCAACGCGGACGTGGTCCTGGACGCCGACCTGTCCCGC
GACAGCAACCACCTGGTGCACACCGGTTCCGGGACGGTGCTGCTGGTGCCGTTCCCCGAC
CCCGGCAAGTGGCGTGCGGTGGACACCGGGTACGCAGGTCAGGGAGCCGATCCGGAGACG
GTACGGCGCCGCCTCGCCGGGTCCCTGGCGCGCGGTCTCGGGCGTCCGGTGGCGGTCTCG
GAGCCGACCTGGGTCTCCGTCTTCCGCGTACAGCAGCGCATGATCACCGCCATGCGCTCC
GGCCGCTGCTTCGTGGCCGGGGACGCCGCGCACGTCCACAGCCCGGCCTCCGGCCAGGGC
ATGAACACCGGCATGCAGGACGCCTACAACCTGGCGTGGAAGCTGGCGGACGTGGTGCGC
GGACACGCGCGGGAAGAGCTGCTGGACACCTACGCCGCCGAGCGCATCCCGGTGGGCGGC
AGGCTGCTGTCCTCGACGCGCACGGCCACGGCCCTGGTGGCGCTGCGCAACGCCGTGGCG
CCGGTGGCCATGCCCGTGGGCCTGTCCTTCCTCAAGGCGGTGCGCCCGCTCAAACGACGC
GTCGAGCACCGGATCATGGCGGGAATGTCCGGCCTCGCCCTGCACTACGCGGACAGTCCG
CTGACGTACGGCACGGGCGACGGGGCGGCAGGGGTACACCCCGGGCACCTGGTCGCGTGC
ACGGAACAGGACGTGGCGCGCCACCCCGGCCTCCGGGCGCTGCGGCAGGCGCTCACCGAT
CCCCGGTGGCTGCTTCTGCTGTTCGCTGATGATGGCGGCGCCGCGGAGCTGGCACTGCGG
TACGGCCGGGCCGTACAGATACGCACCGTCATCCCTCACGAGGACGAAGACGGCCCCGCC
CTCGCCGACCCCGACGACGCTCTGCGGCAGACCCTCGGCGTCCCTCCCGGCGGCTGGGCG
CTGATCAGGCCGGACGGCTATCTGGCCGCGAAGGGGCAGCGGTCCGGCACCACCACCCTG
ACCGCCCGGCTCCAGGCACTGCACCTGCTCCCGGAGGACACCGCGCCCGGCGCCGGTGAC
TCTGCCGGCCGGCCCGCGCCGGACGGCACACGCCGGGGCGTGACGACCGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [9-343]  5.59999999999999e-78 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [9-31]  3.59998852907783e-42 PR00420 [157-172]  3.59998852907783e-42 PR00420 [280-295]  3.59998852907783e-42 PR00420 [295-311]  3.59998852907783e-42 PR00420 [313-331]  3.59998852907783e-42 PR00420 [331-347]  3.59998852907783e-42 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit