close all open/close all

CDS information : Oxtet_00130


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction14,077 / 14,835 / + [in whole cluster]
14,077 / 14,835 / + [in contig]
Location14077..14835 [in whole cluster]
14077..14835 [in contig]
TypeCDS
Length759 bp (252 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)OxyM
GeneoxyM
otcD3
Gene (GenBank)oxyM
EC number
Keyword
Note
Note (GenBank)
  • putative ketoreductase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
P95727
PmId
[1597409] Purification and characterization of a novel enoyl coenzyme A reductase from Streptomyces collinus. (J Bacteriol. , 1992)
[8955309] Cloning and characterization of the gene encoding 1-cyclohexenylcarbonyl coenzyme A reductase from Streptomyces collinus. (J Bacteriol. , 1996)
[10973220] Identification of a cyclohexylcarbonyl CoA biosynthetic gene cluster and application in the production of doramectin. (Nat Biotechnol. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase [OxyM]
MTAINGAPAAGGSVALVIGGTRGIGLAAARKLSAAGSEVLLNYAHDEDGALAAERQLSEE
GGKVRLMRADIGRPAGVVRLLEDIRRTHGRLDVLVHAAGSFHPAPTASPHIGKYLGDGAV
AVGPLLYGAARLGTLMTPDTGRIVAVSSIGARTVVPGYAGLGMAKAALETLVRYLAVELA
GKGVAVNAVAAGKIADGGPVPAQVLEGLLRRTPTGRLATAEEVADVVALLCRPEAGGLHG
QVLTVDGGACLR
selected fasta
>putative oxidoreductase [OxyM]
ATGACAGCGATCAACGGCGCACCGGCGGCAGGCGGTTCGGTGGCACTGGTCATCGGCGGC
ACCCGCGGCATCGGGCTGGCCGCCGCCCGCAAACTGAGCGCGGCGGGCAGCGAGGTGCTG
CTCAACTACGCGCACGACGAGGACGGCGCGCTGGCGGCCGAACGGCAGCTGTCCGAGGAG
GGCGGCAAGGTACGGCTGATGCGCGCGGACATCGGCCGCCCCGCCGGTGTGGTGCGGCTG
CTGGAGGACATCCGGCGCACCCACGGCCGGCTGGACGTCCTGGTGCACGCAGCCGGTTCC
TTCCATCCGGCGCCGACCGCGTCCCCGCACATCGGCAAGTACCTGGGCGACGGCGCCGTG
GCGGTCGGACCGCTGCTGTACGGGGCGGCGCGCCTGGGCACCCTGATGACCCCGGACACG
GGCCGTATCGTCGCCGTCTCCAGCATCGGCGCCCGGACGGTCGTCCCCGGCTACGCGGGT
CTGGGCATGGCCAAGGCGGCCTTGGAGACGCTGGTGCGGTACCTGGCGGTGGAACTCGCC
GGGAAGGGCGTCGCGGTGAACGCGGTGGCCGCGGGCAAGATCGCCGACGGCGGTCCCGTA
CCGGCCCAGGTACTGGAGGGCCTGCTGCGGCGGACCCCGACGGGGCGGCTGGCGACTGCC
GAAGAGGTGGCCGACGTGGTGGCGCTGCTGTGCCGCCCCGAGGCCGGCGGCCTGCACGGA
CAGGTGCTCACCGTGGACGGCGGGGCCTGCCTGCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [14-31]  1.29999924468179e-27 PR00081 [89-100]  1.29999924468179e-27 PR00081 [135-151]  1.29999924468179e-27 PR00081 [161-180]  1.29999924468179e-27 PR00081 [182-199]  1.29999924468179e-27 PR00081 [213-233]  1.29999924468179e-27 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [12-251]  4.39999999999997e-56 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit