close all open/close all

CDS information : Oxtet_00140


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction14,855 / 15,628 / + [in whole cluster]
14,855 / 15,628 / + [in contig]
Location14855..15628 [in whole cluster]
14855..15628 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)OxyN
GeneoxyN
otcD4
Gene (GenBank)oxyN
EC number
Keyword
  • 2nd and 3rd ring
Note
Note (GenBank)
  • putative second ring cyclase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[17631493] Investigation of early tailoring reactions in the oxytetracycline biosynthetic pathway. (J Biol Chem. , 2007)
Related Reference
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)

close this sectionSequence

selected fasta
>cyclase [OxyN]
MRIIDLSTTVDAGRWEVDPVEHEILTPAEGGRHMAEGMRRHHGIDFDPADLPDGELLSLD
TLRLTTHTGTHVDAPSHYGSRARYGTPRHIDQMPLDWFLRPGLKLDLTDEPVGAIGADRI
RRALDEAGRDPRPYDIVLLHTGADRRAGKPEYFTEFAGLDAAATHLLLDFGVRVIGTDAF
SLDAPFGHMIKEYQRTGDRGVLWPAHFVGREREYCQIERLDNLGALPGPDGFLVSCFPFK
IAGAGAGWTRAVAVVEE
selected fasta
>cyclase [OxyN]
ATGCGCATCATCGATCTGTCGACAACCGTGGACGCCGGCCGGTGGGAGGTCGATCCGGTC
GAACACGAAATCCTCACCCCGGCCGAGGGCGGCCGGCACATGGCCGAGGGGATGCGGCGC
CACCACGGCATCGACTTCGACCCCGCCGACCTCCCGGACGGCGAACTGCTGTCCCTCGAC
ACCCTGCGGCTGACCACCCACACCGGCACCCACGTCGACGCCCCGTCGCACTACGGGTCC
CGCGCGCGCTACGGCACGCCGCGCCACATCGACCAGATGCCACTGGACTGGTTTCTGCGG
CCGGGCCTCAAGCTCGACCTTACCGACGAGCCGGTGGGCGCCATCGGAGCCGACCGGATA
CGGCGGGCCCTCGACGAAGCGGGCCGCGACCCGCGTCCGTACGACATCGTGCTGCTGCAC
ACCGGCGCGGACCGGCGGGCCGGAAAGCCGGAGTACTTCACCGAGTTCGCCGGCCTGGAC
GCCGCGGCGACCCACCTGCTGCTCGACTTCGGCGTCCGGGTCATCGGCACCGACGCCTTC
AGCCTCGACGCCCCGTTCGGGCACATGATCAAGGAGTACCAGCGCACCGGCGACCGCGGT
GTGCTGTGGCCCGCCCACTTCGTGGGACGGGAGCGCGAGTACTGCCAGATCGAGCGGCTG
GACAACCTCGGCGCGCTGCCCGGACCGGACGGCTTCTTGGTCTCCTGCTTTCCGTTCAAG
ATCGCGGGAGCGGGGGCGGGGTGGACGCGGGCGGTGGCGGTGGTGGAGGAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [3-185]  1.6e-37 PF04199
PF04199   Cyclase
SignalP No significant hit
TMHMM No significant hit