close all open/close all

CDS information : Oxtet_00150


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction15,734 / 16,795 / + [in whole cluster]
15,734 / 16,795 / + [in contig]
Location15734..16795 [in whole cluster]
15734..16795 [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)OxyO
GeneoxyO
otcD5
Gene (GenBank)oxyO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [OxyO]
MRNRRSQQLHRVVRRASRAGNGPPPAGSVPPRPELGWARLIELTSVLLASVVAVLSLWFS
NRQVGNQLRIAQGELSTTREGQITERYTAAVGQLGEDSVDVRLGGIYALQRNMEDLPRDH
PTIADVLAAYIRTHAGTPPKGGKRVPPDVLAALDVISGRNSAHDGSFVPDLRSTHLPGVE
LGWDRSSPVAADHKRAQLRGAILRDCDLRDARLSGADLRGARLARADLADADLREADLRE
ATPARANLRDADLSDANVRKADLRFADLRGVDLWGTDLRGAVLYRAKLAGLELSEAHLDG
ADLRGADLTDAAVARSQVLASRIDAETRLPPDIARDPEVRARIAQAEAEDDGF
selected fasta
>hypothetical protein [OxyO]
ATGCGAAACCGGCGGAGTCAGCAGTTGCACCGCGTGGTCCGGCGCGCTTCCCGGGCCGGG
AACGGCCCGCCACCGGCCGGCAGCGTCCCTCCGCGTCCGGAGCTGGGCTGGGCCCGTCTG
ATCGAGCTGACTTCGGTACTGCTCGCCTCGGTCGTCGCCGTGCTGAGCCTCTGGTTCTCC
AACCGCCAGGTGGGCAACCAGTTGCGGATCGCCCAGGGCGAGCTGAGCACCACCAGGGAA
GGTCAGATCACCGAGCGGTACACCGCGGCCGTGGGCCAGCTGGGCGAGGATTCGGTGGAC
GTGCGCCTGGGCGGCATCTACGCCCTGCAGCGCAACATGGAGGACCTCCCCCGCGACCAC
CCCACCATCGCCGACGTCCTGGCCGCCTATATCCGCACCCACGCCGGCACCCCGCCGAAA
GGCGGCAAACGGGTGCCACCCGATGTCCTGGCCGCGCTCGACGTGATCAGCGGCCGGAAC
TCCGCCCATGACGGCTCCTTCGTTCCCGACCTCCGCTCCACCCACCTGCCCGGCGTCGAA
CTGGGGTGGGACCGTTCGTCTCCCGTCGCCGCCGACCACAAGCGGGCCCAGTTGCGCGGA
GCGATCCTCCGTGACTGCGACCTGAGGGACGCGCGTCTGAGCGGCGCGGACCTGCGAGGC
GCGAGGCTCGCACGCGCCGATCTGGCCGACGCGGATCTGCGCGAGGCGGACCTCCGGGAA
GCCACTCCGGCGCGGGCGAACCTGCGCGACGCGGACTTGTCCGACGCCAACGTGCGCAAG
GCGGACCTGAGGTTCGCGGATCTTCGCGGCGTGGACCTGTGGGGCACCGATCTGCGCGGC
GCGGTCCTGTACCGGGCGAAACTGGCCGGCCTGGAGCTCAGCGAGGCGCACCTGGACGGA
GCCGACCTCCGCGGTGCTGATCTCACGGACGCGGCGGTGGCACGGAGCCAGGTCCTCGCG
AGCCGCATCGACGCGGAGACCAGGCTCCCACCGGACATCGCCCGCGATCCGGAGGTGCGG
GCCCGGATCGCTCAGGCCGAGGCGGAGGACGATGGTTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001646 Pentapeptide repeat (Repeat)
 [195-228]  1.2e-09 PF00805 [256-291]  1.9e-08 PF00805
PF00805   Pentapeptide
SignalP No significant hit
TMHMM No significant hit