close all open/close all

CDS information : Oxtet_00160


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction17,835 / 16,813 / - [in whole cluster]
17,835 / 16,813 / - [in contig]
Locationcomplement(16813..17835) [in whole cluster]
complement(16813..17835) [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productacyl-ACP thioesterase
Product (GenBank)OxyP
GeneoxyP
otcX3
Gene (GenBank)oxyP
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
  • acyltransferase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[21622525] Genetic characterization of enzymes involved in the priming steps of oxytetracycline biosynthesis in Streptomyces rimosus. (Microbiology. , 2011)
Related Reference
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)

close this sectionSequence

selected fasta
>acyl-ACP thioesterase [OxyP]
MTADTKATGAPAARAPRPVALLLPGQGSQYRRMAAGLYAAEPVFAEAVDEVLGAMGAEGA
RMHADWLAERPELPVDHVLRAQPLLFAVDYALGRLVTSWGIRPVALLGHSIGEMAAATLA
GVFTVRDAARVVLDRVTRLTAAPPGGMLAVAESAASLEPFLGDGVVVGAVNAPRQTVLGG
PEDALRAVGETLRARGITAQRVPALSPFHSPAIAPHARGAEAVLATVERRPPRTVVHSCY
TAAPLTAQQVADPAYWAAHPVDQVRFWPALDGLLAPGGLVVVEAGPGRTLSSLALRHPSV
RRGDCMVVPLSPKRADGPEDDRVALGEAVDALRGEGYRIP
selected fasta
>acyl-ACP thioesterase [OxyP]
ATGACGGCGGACACGAAGGCCACCGGGGCGCCCGCCGCACGGGCGCCCCGGCCGGTGGCG
CTGCTGCTGCCCGGCCAGGGCTCCCAGTACCGGCGGATGGCGGCGGGGCTGTACGCGGCC
GAGCCGGTCTTCGCCGAGGCGGTCGACGAGGTGCTGGGCGCGATGGGGGCCGAGGGCGCC
CGTATGCACGCCGACTGGCTGGCCGAGCGGCCGGAGCTGCCGGTGGACCACGTACTGCGG
GCGCAGCCGCTGCTGTTCGCCGTCGACTACGCGCTCGGCCGCCTGGTGACGAGCTGGGGC
ATCCGTCCGGTGGCGCTGCTCGGCCACAGCATCGGCGAGATGGCGGCCGCCACGCTCGCC
GGGGTGTTCACGGTGCGCGACGCCGCGCGGGTGGTGCTCGACCGGGTGACGCGGCTGACG
GCCGCGCCCCCGGGCGGCATGCTGGCGGTGGCGGAGTCCGCCGCGTCGCTGGAACCTTTC
CTCGGCGACGGCGTGGTGGTCGGCGCCGTCAACGCGCCGCGGCAGACCGTACTCGGAGGG
CCGGAGGACGCGCTGCGCGCCGTGGGGGAGACCCTGCGGGCCCGCGGCATCACCGCCCAG
CGGGTCCCCGCGCTCAGCCCGTTCCACAGCCCGGCGATCGCCCCGCACGCCAGGGGCGCC
GAGGCGGTGCTCGCCACGGTGGAACGCCGGCCGCCGCGCACCGTGGTCCACTCCTGCTAC
ACGGCCGCACCACTGACGGCCCAGCAGGTCGCCGACCCCGCGTACTGGGCCGCGCACCCC
GTGGACCAGGTGCGCTTCTGGCCCGCTCTGGACGGGCTGCTGGCGCCCGGCGGACTGGTG
GTGGTCGAAGCGGGACCCGGCCGTACGCTGTCGAGCCTCGCCCTGCGCCACCCCTCCGTA
CGCCGTGGGGACTGCATGGTCGTACCGCTGTCACCTAAGCGGGCGGATGGGCCGGAGGAT
GACCGGGTGGCTTTGGGGGAGGCGGTGGACGCCTTGCGGGGTGAGGGGTACCGGATTCCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [13-142]  2.4e-53 G3DSA:3.40.366.10 [206-310]  2.4e-53 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [23-291]  1.80000000000002e-45 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [18-298]  7.79998304125571e-46 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [143-204]  2.79999889404114e-12 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [22-315]  1.10000150671643e-59 SM00827
SM00827   PKS_AT
SignalP No significant hit
TMHMM No significant hit