close all open/close all

CDS information : Oxtet_00170


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction18,911 / 17,832 / - [in whole cluster]
18,911 / 17,832 / - [in contig]
Locationcomplement(17832..18911) [in whole cluster]
complement(17832..18911) [in contig]
TypeCDS
Length1,080 bp (359 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-4 aminotransferase
Product (GenBank)OxyQ
GeneoxyQ
otcX2
Gene (GenBank)oxyQ
EC number2.6.1.-
Keyword
Note
Note (GenBank)
  • putative aminotransferase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>C-4 aminotransferase [OxyQ]
MRELPEFPWDVLLPYKKRAAAHPDGLVNLALGEPVDATPDVLRDALAAATDAPGYPPTEG
TPALREAAAAWLRRRLGVTVDPSAVLPAVGTKELIAWLPAMLGTGPGDTVAFPRLAFPTF
DVSARLAGARGRPVDSPLELGSEPVKVVWLNSPSNPEGRVLSVPELREIVAWARDRGAVL
VNDECYIEYGWDRRPVSLLDSAVCGGSHDGLLAVHSLSKRSNLAGYRAGVCSGDPALIGR
LLQVRKHAGHAVPAPVQAAMVAALEDDAHVERQRDRYAYRRRVLRTALEGAGFRVEHSEG
GLFLWATRGEPCWPAVQKLADLGILVAPGAFYGEAGEQYVRIAFTATDERIAAAAARLT
selected fasta
>C-4 aminotransferase [OxyQ]
ATGAGGGAACTGCCCGAATTTCCGTGGGATGTGCTGCTGCCGTACAAGAAGCGCGCCGCG
GCCCACCCCGACGGGCTGGTCAACCTGGCGCTGGGCGAACCGGTCGACGCCACGCCCGAC
GTGCTGCGCGACGCCCTCGCGGCGGCGACCGACGCGCCCGGCTACCCGCCCACGGAGGGG
ACGCCCGCGCTCCGCGAAGCGGCCGCCGCATGGCTGCGCCGCCGCCTGGGCGTGACGGTG
GACCCCTCGGCCGTACTGCCCGCGGTCGGCACCAAGGAGCTGATCGCCTGGCTCCCGGCG
ATGCTGGGCACCGGCCCCGGCGACACGGTGGCCTTTCCCCGGCTGGCGTTTCCCACCTTC
GACGTCAGCGCGCGCCTCGCGGGCGCGCGGGGGCGCCCGGTGGATTCACCGCTGGAGCTC
GGCAGTGAACCGGTCAAGGTGGTCTGGCTCAACTCGCCGTCCAACCCGGAGGGCCGGGTG
CTGTCCGTACCCGAGCTGCGCGAGATCGTGGCCTGGGCGCGGGACCGGGGCGCCGTCCTC
GTCAACGACGAGTGCTACATCGAATACGGGTGGGACCGGCGGCCGGTGTCGCTGCTGGAC
TCGGCGGTGTGCGGCGGCAGTCACGATGGTCTGCTGGCGGTGCACTCGCTGTCCAAGCGG
TCCAACCTCGCGGGCTACCGCGCGGGCGTCTGCTCCGGCGACCCGGCCCTGATCGGGCGC
CTCCTCCAGGTACGCAAGCACGCCGGGCACGCGGTCCCGGCCCCCGTACAGGCGGCCATG
GTGGCCGCCCTGGAGGACGACGCCCACGTGGAGCGGCAGCGAGACCGGTACGCCTACAGG
CGGCGCGTTCTGCGCACGGCCCTGGAGGGGGCCGGGTTCCGCGTCGAGCATTCCGAAGGC
GGCCTGTTCCTGTGGGCCACCCGGGGTGAGCCCTGCTGGCCCGCCGTACAGAAGCTGGCC
GATCTCGGCATCCTCGTCGCACCCGGTGCCTTCTACGGCGAGGCCGGTGAGCAGTACGTA
CGGATTGCGTTCACGGCGACCGACGAACGCATCGCCGCGGCCGCCGCCCGGCTGACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001176 1-aminocyclopropane-1-carboxylate synthase (Family)
 [107-128]  6.40000038788486e-05 PR00753 [142-166]  6.40000038788486e-05 PR00753 [210-234]  6.40000038788486e-05 PR00753
PR00753   ACCSYNTHASE
IPR004839 Aminotransferase, class I/classII (Domain)
 [26-358]  3.89999999999997e-44 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [38-258]  9e-51 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [259-358]  7.90000000000001e-11 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [1-358]  1.90000694315261e-85 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
IPR019880 Succinyldiaminopimelate transaminase, DapC, actinobacteria (Family)
 [4-359]  TIGR03539
TIGR03539   DapC_actino
SignalP No significant hit
TMHMM No significant hit