close all open/close all

CDS information : Oxtet_00180


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction19,336 / 18,908 / - [in whole cluster]
19,336 / 18,908 / - [in contig]
Locationcomplement(18908..19336) [in whole cluster]
complement(18908..19336) [in contig]
TypeCDS
Length429 bp (142 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
Product (GenBank)OxyR
GeneoxyR
otcX1
Gene (GenBank)oxyR
EC number
Keyword
Note
Note (GenBank)
  • putative PNP-oxidase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)
Family/Domain
FD
IPR011576

close this sectionSequence

selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [OxyR]
MPFTQKEITYLRAQGYGRLATVGAHGEPHNVPVSFEIDEERGTIEITGRDMGRSRKFRNV
AKSDRVAFVVDDVPCRDPEVVRAVVIHGTAQALPTGGRERRPHCADEMIRIHPRRIVTWG
IEGDLSTGVHARDITAEDGGRR
selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [OxyR]
ATGCCGTTCACCCAGAAGGAAATCACCTACCTGCGCGCGCAGGGCTACGGCCGTCTGGCG
ACGGTCGGCGCCCATGGAGAACCCCACAACGTGCCCGTCTCGTTCGAGATCGACGAGGAG
CGCGGCACCATCGAGATCACCGGCCGGGACATGGGCCGCAGCCGCAAGTTCCGGAACGTG
GCGAAGAGCGACCGGGTCGCCTTCGTCGTGGACGACGTGCCGTGCCGCGACCCCGAGGTG
GTCCGCGCCGTCGTCATCCACGGCACGGCCCAGGCGCTGCCCACCGGCGGCAGGGAGCGC
CGGCCGCACTGCGCCGACGAGATGATCCGCATCCACCCCCGGCGCATCGTCACCTGGGGC
ATCGAAGGGGACCTGTCCACCGGGGTCCACGCACGCGACATCACGGCCGAGGACGGAGGA
CGGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009002 FMN-binding split barrel-related (Domain)
 [3-124]  7.00000734129907e-21 SSF50475
SSF50475   FMN_binding
IPR011576 Pyridoxamine 5'-phosphate oxidase-like, FMN-binding domain (Domain)
 [4-94]  6.60000000000002e-12 PF01243
PF01243   Pyridox_oxidase
IPR012349 FMN-binding split barrel (Domain)
 [8-102]  1.99999999999999e-18 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
IPR024031 F420-dependent enzyme, PPOX class, family MSMEG5819, probable (Family)
 [3-121]  4.9e-41 TIGR04023
TIGR04023   PPOX_MSMEG_5819
SignalP No significant hit
TMHMM No significant hit