close all open/close all

CDS information : Oxtet_00190


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction19,492 / 21,003 / + [in whole cluster]
19,492 / 21,003 / + [in contig]
Location19492..21003 [in whole cluster]
19492..21003 [in contig]
TypeCDS
Length1,512 bp (503 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative C-6 hydroxylase
Product (GenBank)OxyS
GeneoxyS
otcC
Gene (GenBank)oxyS
EC number
Keyword
Note
Note (GenBank)
  • oxygenase; similar to OtcC of GenBank Accession Number AAX48941
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q58PK7
PmId
[16148009] Ablation of the otcC gene encoding a post-polyketide hydroxylase from the oxytetracyline biosynthetic pathway in Streptomyces rimosus results in novel polyketides with altered chain length. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative C-6 hydroxylase [OxyS]
MRYDVVIAGAGPTGLMLACELRLAGARTLVLERLAEPVDFSKALGVHARTVELLDMRGLG
EGFQAEAPKLRGGNFASLGVPLDFSSFDTRHPYALFVPQVRTEELLTGRALELGAELRRG
HAVTALEQDADGVTVSVTGPEGPYEVECAYLVGCDGGGSTVRKLLGIDFPGQDPHMFAVI
ADARFREELPHGEGMGPMRPYGVMRHDLRAWFAAFPLEPDVYRATVAFFDRPYADRRAPV
TEEDVRAALTEVAGSDFGMHDVRWLSRLTDTSRQAERYRDGRVLLAGDACHIHLPAGGQG
LNLGFQDAVNLGWKLGATIAGTAPPELLDTYEAERRPIAAGVLRNTRAQAVLIDPDPRYE
GLRELMIELLHVPETNRYLAGLISALDVRYPMAGEHPLLGRRVPDLPLVTEDGTRQLSTY
FHAARGVLLTLGCDQPLADEAAAWKDRVDLVAAEGVADPGSAVDGLTALLVRPDGYICWT
AAPETGTDGLTDALRTWFGPPAM
selected fasta
>putative C-6 hydroxylase [OxyS]
ATGCGGTACGACGTGGTGATCGCCGGCGCCGGGCCGACCGGCCTGATGCTCGCCTGCGAA
CTGCGCCTGGCCGGTGCCAGGACCCTGGTGCTGGAACGCCTGGCGGAGCCGGTCGACTTC
TCCAAGGCCCTCGGTGTGCACGCGCGCACCGTCGAGCTGCTGGACATGCGCGGGCTGGGC
GAGGGGTTCCAGGCCGAGGCGCCGAAGCTGCGCGGCGGGAACTTCGCCAGCCTCGGAGTA
CCCCTGGACTTCTCGTCGTTCGACACCCGGCACCCGTACGCGCTGTTCGTCCCCCAGGTG
CGTACCGAGGAGCTGCTGACCGGGCGGGCCCTGGAGCTGGGGGCCGAGCTGCGGCGCGGG
CACGCGGTGACGGCGCTGGAGCAGGACGCCGACGGCGTGACCGTCTCCGTCACCGGGCCC
GAGGGGCCGTACGAGGTCGAGTGCGCGTACCTGGTGGGCTGCGACGGCGGCGGCAGCACC
GTACGCAAGCTGCTCGGCATCGACTTCCCCGGGCAGGACCCGCACATGTTCGCGGTGATC
GCGGATGCCCGGTTCCGTGAGGAGCTGCCGCACGGGGAGGGCATGGGACCGATGCGGCCG
TACGGCGTCATGCGGCACGACCTGCGCGCCTGGTTCGCCGCCTTCCCGCTGGAGCCGGAC
GTCTACCGGGCCACGGTCGCCTTCTTCGACCGGCCCTACGCCGACCGCCGGGCGCCGGTC
ACCGAGGAGGACGTGCGGGCCGCGCTGACCGAGGTGGCCGGCAGCGACTTCGGGATGCAC
GACGTGCGCTGGCTCTCCCGGCTCACCGACACCTCACGCCAGGCCGAGCGGTACCGCGAC
GGCCGGGTCCTGCTGGCCGGCGACGCCTGCCACATCCACCTGCCCGCGGGCGGCCAGGGC
CTCAACCTGGGCTTCCAGGACGCGGTGAACCTGGGCTGGAAGCTGGGCGCGACCATCGCG
GGCACGGCTCCGCCGGAGCTGCTGGACACCTACGAGGCCGAGCGCCGCCCGATCGCCGCC
GGCGTACTGCGCAACACCCGCGCGCAAGCCGTGCTGATCGACCCGGACCCGCGTTACGAG
GGGCTGCGGGAGCTGATGATCGAGCTGCTGCACGTCCCGGAGACCAACCGCTATCTGGCG
GGCCTCATCTCGGCGCTGGACGTGCGGTACCCCATGGCGGGCGAGCACCCGCTGCTGGGG
CGCCGCGTACCGGACCTGCCGCTCGTCACCGAGGACGGCACCCGGCAGCTGAGCACGTAC
TTCCACGCGGCGCGCGGCGTCCTGCTGACGCTCGGCTGCGACCAGCCGCTCGCCGACGAG
GCCGCGGCCTGGAAGGACCGGGTGGACCTGGTCGCGGCCGAGGGCGTCGCGGACCCGGGC
TCCGCGGTCGACGGGCTGACCGCGCTGCTCGTACGCCCCGACGGCTACATCTGCTGGACC
GCGGCTCCGGAGACGGGTACGGACGGGCTCACCGACGCCCTGCGCACCTGGTTCGGGCCG
CCCGCCATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [3-345]  3.90000000000001e-89 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [4-26]  3.29999077503323e-43 PR00420 [147-162]  3.29999077503323e-43 PR00420 [280-295]  3.29999077503323e-43 PR00420 [295-311]  3.29999077503323e-43 PR00420 [313-331]  3.29999077503323e-43 PR00420 [331-347]  3.29999077503323e-43 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit