close all open/close all

CDS information : Oxtet_00200


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction21,064 / 22,098 / + [in whole cluster]
21,064 / 22,098 / + [in contig]
Location21064..22098 [in whole cluster]
21064..22098 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductSAM-dependent N,N-dimethyltransferase
Product (GenBank)OxyT
GeneoxyT
otcZ
Gene (GenBank)oxyT
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • putative N-methyltransferase
Reference
ACC
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[18422316] Identifying the minimal enzymes required for anhydrotetracycline biosynthesis. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>SAM-dependent N,N-dimethyltransferase [OxyT]
MTTTPLAPVAQARSLLQLTTAYHQAKALHSAVELGLFDLLADGPATAEEVKDRLRIVHPL
AKEFLDALVALELLEADGDRYRNSPAAQAFLVSGASEYLGGTVLQHARKHYHVWAGLTTA
LQEGEAGSGAEAHGPEAYPKHYEDPERARQVMAHFDTFSSFTAEELARRVDWSGYGSFID
IGGARGNLATRVALAHPHLHGAVFDLPALAPLAGELIRERGLEGRVRFHGGDFLTDPLPS
ADAVVTGHVLPDWPVPQRRKLLARIHEALPSGGALVVYDLMTDPATTTVHDVLQRLNHGL
IRGDSSSSSVEEYRAEIEEAGFRVRQAERIDNLLGDWLIVAVKP
selected fasta
>SAM-dependent N,N-dimethyltransferase [OxyT]
ATGACCACCACACCGCTCGCCCCCGTGGCCCAGGCCCGCTCGCTGCTGCAGCTGACCACC
GCGTACCACCAGGCGAAGGCCCTGCACAGCGCCGTGGAGCTGGGCCTGTTCGACCTGCTC
GCCGACGGGCCCGCGACCGCCGAGGAGGTGAAGGACCGGCTGCGGATCGTCCATCCGCTG
GCCAAGGAGTTCCTCGACGCGCTCGTCGCGCTGGAGTTGCTGGAAGCGGACGGCGACCGC
TACCGCAACTCCCCCGCCGCCCAGGCGTTCCTGGTGTCCGGCGCCTCCGAATACCTGGGC
GGCACCGTCCTCCAGCACGCCCGCAAGCACTACCACGTATGGGCCGGGCTGACGACGGCG
CTCCAGGAGGGCGAGGCGGGTTCCGGCGCCGAAGCGCACGGGCCCGAGGCGTACCCCAAG
CACTACGAGGACCCGGAGCGGGCCCGTCAGGTCATGGCGCACTTCGACACCTTCAGCTCC
TTCACGGCCGAGGAGCTGGCGCGCCGCGTCGACTGGAGCGGGTACGGGTCCTTCATCGAC
ATCGGCGGCGCACGGGGCAACCTCGCCACGCGGGTGGCCCTGGCCCACCCGCACCTGCAC
GGCGCCGTGTTCGACCTGCCCGCGCTGGCCCCGCTGGCCGGCGAGCTGATCCGTGAGCGC
GGCCTCGAAGGCCGCGTCCGCTTCCACGGCGGCGACTTCCTGACCGACCCGCTGCCGTCC
GCGGACGCCGTGGTCACCGGGCACGTACTGCCCGACTGGCCGGTACCGCAGCGGCGCAAG
CTCCTCGCGCGCATCCACGAGGCGCTGCCCTCCGGCGGCGCGCTGGTGGTCTACGACCTG
ATGACGGATCCGGCCACCACGACGGTGCACGACGTACTGCAACGGCTCAACCACGGCCTC
ATCCGCGGCGACAGCTCGTCCAGCAGCGTCGAGGAGTACCGCGCGGAGATCGAGGAGGCC
GGCTTCCGGGTGCGGCAGGCGGAGCGCATCGACAACCTCCTCGGTGACTGGCTGATAGTC
GCCGTCAAGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [79-288]  2.1e-47 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [11-87]  9.9e-27 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [2-343]  8.60000664726925e-10 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit