close all open/close all
Oxtet_00200 Oxtet_00200   last last

CDS information : Oxtet_00210


close this sectionLocation

Organism
StrainATCC 10970 (=NBRC 12907)
Entry nameOxytetracycline
Contig
Start / Stop / Direction22,257 / 24,248 / + [in whole cluster]
22,257 / 24,248 / + [in contig]
Location22257..24248 [in whole cluster]
22257..24248 [in contig]
TypeCDS
Length1,992 bp (663 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative oxytetracycline resistance protein
Product (GenBank)
GeneotrA
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
Related Reference
ACC
Q55002
PmId
[2710100] Molecular cloning of resistance genes and architecture of a linked gene cluster involved in biosynthesis of oxytetracycline by Streptomyces rimosus. (Mol Gen Genet. , 1989)
[1809836] Characterization of an oxytetracycline-resistance gene, otrA, of Streptomyces rimosus. (Mol Microbiol. , 1991)

close this sectionSequence

selected fasta
>putative oxytetracycline resistance protein
MNKLNLGILAHVDAGKTSLTERLLHRTGVIDEVGSVDAGTTTTDSMELERQRGITIRSAV
ATFVLDDLKVNLIDTPGHSDFISEVERALGVLDGAVLVVSAVEGVQPQTRILMRTLRRLG
IPTLVFVNKIDRGGARPDGVLREIRDRLTPAAVALSAVADAGTPRARAIALGPDTDPDFA
VRVGELLADHDDAFLTAYLDEEHVLTEKEYAEELAAQTARGLVHPVYFGSALTGEGLDHL
VHGIRELLPSVHASQDAPLRATVFKVDRGARGEAVAYLRLVSGTLGTRDSVTLHRVDHTG
RVTEHAGRITALRVFEHGSATSETRATAGDIAQAWGLKDVRVGDRAGHLDGPPPRNFFAP
PSLETVIRPERPEEAGRLHAALRMLDEQDPSIDLRQDEENAAGAVVRLYGEVQKEILGST
LAESFGVRVRFDPTRTVCIEKPVGTGEALIELDTRTHNYFWGAPWVCASDRPSPARAITF
RLAVELGSLPLAFHKAIEETVHTTLRHGLYGWQVTDCAVTLTRTGVRSPVSAADDFRKAN
ARLVLMDALGRAGTEVHEPVSSFELEVPAARLSPVLAKLAELGATPGVPTAEGDVFRLEG
TMPTSLVHDFNQRVPGLTQGEGVFLAEHRGYRPAVGQPPVRPRPEGPNPLNRDEYILHVL
KRV
selected fasta
>putative oxytetracycline resistance protein
ATGAACAAGCTGAATCTGGGCATCCTGGCCCACGTTGACGCCGGCAAGACCAGCCTCACC
GAGCGCCTGCTGCACCGCACCGGTGTGATCGACGAGGTCGGCAGCGTGGACGCCGGCACC
ACGACGACCGACTCGATGGAGCTGGAGCGGCAGCGCGGCATCACCATCCGGTCCGCCGTG
GCCACGTTCGTCCTGGACGATCTCAAGGTCAACCTCATCGACACCCCGGGCCACTCCGAC
TTCATCTCCGAGGTCGAGCGGGCGCTCGGGGTGCTCGACGGCGCGGTCCTGGTGGTCTCG
GCCGTCGAGGGCGTCCAGCCGCAGACCCGCATCCTGATGCGGACCCTGCGCAGGCTGGGC
ATTCCCACGCTGGTCTTCGTCAACAAGATCGACCGGGGCGGCGCGCGTCCCGACGGTGTG
CTGCGGGAGATCCGCGACCGGCTCACCCCCGCCGCGGTGGCACTGTCCGCCGTGGCGGAC
GCCGGCACGCCGCGGGCCCGCGCGATCGCGCTCGGCCCGGACACCGACCCGGACTTCGCC
GTCCGGGTCGGTGAGCTGCTGGCCGACCACGACGACGCGTTCCTCACCGCCTACCTGGAC
GAGGAACACGTACTGACCGAGAAGGAGTACGCGGAGGAACTGGCCGCGCAGACCGCGCGC
GGTCTGGTGCACCCGGTGTACTTCGGGTCCGCGCTGACCGGCGAGGGCCTGGACCATCTG
GTGCACGGCATCCGGGAGTTGCTGCCGTCCGTGCACGCGTCGCAGGACGCGCCGCTGCGG
GCCACCGTGTTCAAGGTGGACCGTGGCGCGCGCGGCGAGGCCGTCGCGTACCTGCGGCTG
GTCTCCGGCACGCTGGGCACCCGCGATTCGGTGACGCTGCACCGCGTCGACCACACCGGC
CGGGTCACCGAGCACGCCGGACGCATCACCGCGCTGCGGGTCTTCGAGCACGGGTCGGCC
ACCAGCGAGACCCGGGCGACCGCCGGGGACATCGCGCAGGCGTGGGGCCTGAAGGACGTA
CGGGTCGGTGACCGGGCCGGGCACCTCGACGGTCCCCCGCCGCGCAACTTCTTCGCGCCG
CCCAGCCTGGAGACCGTGATCAGGCCGGAGCGCCCGGAGGAAGCGGGACGGCTGCACGCC
GCGCTGCGCATGCTGGACGAGCAGGACCCCTCGATCGACCTGCGGCAGGACGAGGAGAAC
GCGGCCGGCGCGGTGGTCCGCCTCTACGGGGAGGTGCAGAAGGAGATCCTCGGCAGCACG
CTCGCGGAGTCCTTCGGCGTACGGGTGCGCTTCGACCCGACCCGTACGGTCTGCATCGAA
AAGCCCGTGGGGACCGGCGAGGCGCTGATCGAGCTGGACACGCGGACGCACAACTACTTC
TGGGGCGCACCGTGGGTCTGCGCGTCGGACCGGCCGAGCCCGGCGCGGGCGATCACGTTC
CGTTTGGCGGTGGAACTGGGCTCGCTCCCCCTGGCCTTCCACAAGGCCATCGAGGAGACG
GTGCACACCACCCTGCGGCACGGTCTGTACGGCTGGCAGGTCACCGACTGCGCCGTCACC
CTGACCCGTACCGGCGTTCGCAGTCCGGTCAGCGCGGCCGACGACTTCCGCAAGGCCAAC
GCGCGCTTGGTCCTGATGGACGCGCTCGGCAGGGCCGGTACGGAGGTGCACGAGCCGGTC
AGCTCCTTCGAACTGGAGGTGCCCGCCGCCCGGCTCAGCCCGGTACTTGCGAAACTCGCG
GAACTGGGCGCGACGCCCGGTGTGCCCACGGCCGAGGGGGACGTCTTCCGCCTGGAGGGC
ACGATGCCGACCAGCCTCGTGCACGACTTCAACCAGCGGGTTCCCGGACTGACCCAGGGC
GAGGGCGTGTTCCTGGCCGAGCACCGGGGCTACCGGCCCGCCGTCGGACAGCCGCCCGTG
CGGCCGCGGCCCGAGGGGCCCAACCCGCTCAACCGCGACGAGTACATCCTGCACGTGCTC
AAGCGCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000640 Translation elongation factor EFG/EF2, C-terminal (Domain)
 [558-638]  5e-07 G3DSA:3.30.70.240
G3DSA:3.30.70.240   Transl_elong_EFG/EF2_C
 [556-638]  2.3e-11 PF00679
PF00679   EFG_C
IPR000795 Protein synthesis factor, GTP-binding (Domain)
 [5-18]  2.09999806691534e-16 PR00315 [51-59]  2.09999806691534e-16 PR00315 [71-81]  2.09999806691534e-16 PR00315 [87-98]  2.09999806691534e-16 PR00315 [123-132]  2.09999806691534e-16 PR00315
PR00315   ELONGATNFCT
 [44-59]  PS00301
PS00301   EFACTOR_GTP
 [2-250]  3.29999999999997e-56 PF00009
PF00009   GTP_EFTU
IPR002127 Tetracycline resistance protein, TetO/TetQ/TetM (Family)
 [109-132]  3.39999972437717e-24 PR01037 [223-245]  3.39999972437717e-24 PR01037 [277-303]  3.39999972437717e-24 PR01037 [490-512]  3.39999972437717e-24 PR01037 [524-541]  3.39999972437717e-24 PR01037
PR01037   TCRTETOQM
IPR004161 Translation elongation factor EFTu/EF1A, domain 2 (Domain)
 [275-345]  2.5e-08 PF03144
PF03144   GTP_EFTU_D2
IPR005225 Small GTP-binding protein domain (Domain)
 [1-136]  1.9e-31 TIGR00231
TIGR00231   Small_GTP
IPR005517 Translation elongation factor EFG/EF2, domain IV (Domain)
 [437-553]  9.29999999999998e-17 PF03764
PF03764   EFG_IV
IPR009000 Translation elongation/initiation factor/Ribosomal, beta-barrel (Domain)
 [233-360]  1.60000240695997e-19 SSF50447
SSF50447   Translat_factor
IPR009022 Elongation factor G/III/V (Domain)
 [358-436]  3.89999861795218e-12 SSF54980 [555-645]  1e-09 SSF54980
SSF54980   EFG_III_V
IPR014721 Ribosomal protein S5 domain 2-type fold, subgroup (Domain)
 [476-555]  2.3e-11 G3DSA:3.30.230.10
G3DSA:3.30.230.10   Ribosomal_S5_D2-type_fold
IPR020568 Ribosomal protein S5 domain 2-type fold (Domain)
 [473-553]  2.39999798157265e-09 SSF54211
SSF54211   Ribosomal_S5_D2-typ_fold
SignalP No significant hit
TMHMM No significant hit
Oxtet_00200 Oxtet_00200   last last