close all open/close all
first first   Oxzol_00020 Oxzol_00020

CDS information : Oxzol_00010


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction5,702 / 6,727 / + [in whole cluster]
5,702 / 6,727 / + [in contig]
Location5702..6727 [in whole cluster]
5702..6727 [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative esterase
Product (GenBank)lipase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf -6
Reference
ACC
Related Reference
ACC
O52270
PmId
[9464382] A cold-adapted lipase of an Alaskan psychrotroph, Pseudomonas sp. strain B11-1: gene cloning and enzyme purification and characterization. (Appl Environ Microbiol. , 1998)
ACC
Q8NKS0
PmId
[12147492] Extremely stable and versatile carboxylesterase from a hyperthermophilic archaeon. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative esterase [lipase]
MEADVPPARERPVLERRTRAFAEAYACPPVGTSDEAASRTRMAALWDGGGLDEPDVEEEW
LALPGPDGERVRVRILRPAGAAGTPGAPGTPGAAGREEEPLPVVLYLHALGWMLTDAYAH
RQLLSDLVLGADAAVVVPEYEGPRDARHPHAVERAHTVARWLARHGAECGLDGSRMAVVG
ASAGAQQAAALTLVARERGGPHLRHQVLVCPVTDAAMDTPSYRHFEDGYFLGRSAMRGYW
QRYAPDRASRADGVVSPLRAPLGGLRGLPPALVLTAEADVLRDEGEAYAARLREADVPVV
SIRYQGTIHGFLLFDLLRATEASRAARIQVTDTLHAALHGA
selected fasta
>putative esterase [lipase]
GTGGAAGCAGACGTTCCCCCCGCCAGGGAGAGACCTGTCCTCGAACGGCGGACGCGGGCC
TTCGCCGAGGCGTACGCCTGCCCCCCGGTGGGAACGTCCGACGAGGCCGCGTCCCGTACG
CGCATGGCGGCGCTCTGGGACGGGGGCGGTCTCGACGAACCGGACGTCGAGGAGGAGTGG
CTGGCCCTGCCGGGGCCCGACGGCGAGCGCGTCAGGGTACGCATCCTGCGCCCGGCGGGA
GCGGCGGGCACACCGGGGGCGCCGGGCACACCCGGAGCGGCGGGACGGGAGGAGGAACCC
CTCCCCGTCGTGCTCTACCTGCACGCCCTCGGCTGGATGCTCACCGACGCCTACGCCCAC
CGGCAGCTCCTCTCCGACCTCGTCCTCGGCGCCGACGCGGCCGTGGTCGTCCCCGAGTAC
GAGGGGCCGCGCGACGCCAGGCACCCCCACGCCGTGGAGCGCGCCCACACCGTCGCCCGA
TGGCTCGCGCGGCACGGTGCCGAGTGCGGCCTCGACGGGAGCCGGATGGCCGTCGTCGGG
GCCAGCGCGGGCGCCCAGCAGGCTGCCGCCCTCACCCTGGTGGCGCGGGAGCGGGGCGGC
CCGCACCTCCGCCACCAGGTGCTCGTCTGCCCGGTGACGGATGCCGCGATGGACACGCCG
TCGTACCGCCACTTCGAGGACGGGTACTTCCTCGGGCGCTCCGCGATGCGCGGCTACTGG
CAGCGGTACGCGCCCGACCGGGCGAGCCGCGCGGACGGCGTGGTCTCCCCGCTGCGCGCG
CCGCTCGGCGGCCTGCGCGGTCTGCCGCCGGCGCTGGTGCTCACGGCCGAGGCCGATGTG
CTCCGCGACGAGGGGGAGGCGTACGCGGCGCGGCTGCGGGAGGCGGACGTACCCGTCGTG
TCGATCCGCTACCAGGGCACGATCCACGGCTTCCTGCTCTTCGACCTGCTGCGGGCCACC
GAGGCCTCCAGGGCGGCCCGCATCCAGGTGACGGACACCCTGCACGCGGCCCTGCACGGG
GCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013094 Alpha/beta hydrolase fold-3 (Domain)
 [104-312]  1e-52 PF07859
PF07859   Abhydrolase_3
SignalP
 [1-22]  0.136 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Oxzol_00020 Oxzol_00020