close all open/close all

CDS information : Oxzol_00020


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction7,739 / 6,732 / - [in whole cluster]
7,739 / 6,732 / - [in contig]
Locationcomplement(6732..7739) [in whole cluster]
complement(6732..7739) [in contig]
TypeCDS
Length1,008 bp (335 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative AraC family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf -5
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
P72312
PmId
[8855219] Transcriptional regulation of the Rhodococcus rhodochrous J1 nitA gene encoding a nitrilase. (Proc Natl Acad Sci U S A. , 1996)
Family/Domain
FD
IPR020449, IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [transcriptional regulator]
MSLLGGSGGSSLGGVVLLLDLSTVAPRERAEAFRHALTDSLVPNDIAHEEPETGIHARME
LWSVGGLDLFSTRNSGFEVRRGERHVRHHRSRPVVSVSLQPRGTHRAEVAGRRNLLGQDD
ICVFHELSPRTYGWSGDGSSQSIMFDMDRLGVPVETVVGAAPHLRASPMYDLVLNHLRGV
WRDPGRLAADPGAEALATATTGLVRALLLSAALSDDSPAVRSALDETLLTRVLAYARRHL
ADRDLTPERIAQEHAVSVRALYLLLNDAGISLEQWLITERLARARQMLAASRYDRLTVAA
VAARCGFSSPSHFSRRFRAAYGSSPGDWRRLSRSG
selected fasta
>putative AraC family transcriptional regulator [transcriptional regulator]
ATGTCCCTCCTTGGCGGTTCTGGGGGTAGTTCTCTTGGGGGTGTTGTGCTGCTGCTCGAT
CTCTCCACCGTGGCACCGCGCGAGCGGGCCGAGGCGTTCCGGCACGCGCTGACGGACTCC
CTGGTGCCCAACGACATCGCGCACGAGGAGCCCGAGACGGGCATCCACGCGCGCATGGAG
CTGTGGAGCGTGGGAGGGCTCGACCTGTTCTCGACGCGCAACTCGGGCTTCGAGGTGCGC
CGCGGCGAACGGCACGTGCGCCACCACCGGAGCCGCCCCGTGGTCTCCGTCTCCCTGCAG
CCGCGCGGCACCCACCGCGCCGAGGTCGCCGGACGGCGGAACCTCCTCGGCCAGGACGAC
ATCTGCGTCTTCCACGAGCTGTCGCCCCGCACGTACGGCTGGTCCGGCGACGGTTCGTCG
CAGTCCATCATGTTCGACATGGACCGCCTCGGCGTGCCGGTGGAGACGGTCGTCGGGGCC
GCGCCGCACCTGCGCGCGAGCCCGATGTACGACCTGGTCCTGAACCATCTGCGCGGAGTC
TGGCGCGACCCCGGGCGCCTCGCGGCCGACCCGGGCGCGGAGGCCCTCGCCACGGCCACG
ACCGGACTCGTCCGCGCGCTGCTCCTCTCGGCCGCGCTCTCCGACGACTCCCCCGCCGTC
CGCTCGGCGCTGGACGAGACCCTGCTCACCAGGGTCCTCGCCTACGCACGCAGGCACCTC
GCGGACCGCGACCTGACCCCGGAGCGGATCGCCCAGGAGCACGCCGTCTCCGTACGCGCC
CTCTACCTCCTCCTCAACGACGCGGGGATCAGCCTCGAACAGTGGCTCATCACCGAACGC
CTCGCCAGGGCGCGGCAAATGCTGGCCGCGTCCCGCTACGACCGCCTGACGGTCGCGGCG
GTGGCCGCCCGGTGCGGGTTCAGCAGCCCGAGCCACTTCAGCCGCCGGTTCCGGGCGGCG
TACGGCTCCTCCCCCGGCGACTGGCGGCGGCTCAGCCGCAGCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [277-330]  4.19999771339581e-13 SSF46689
SSF46689   Homeodomain_like
 [280-330]  4.40000000000001e-15 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [244-329]  1.20000117458134e-26 SM00342
SM00342   HTH_ARAC
 [230-331]  PS01124
PS01124   HTH_ARAC_FAMILY_2
IPR018062 HTH domain AraC-type, conserved site (Conserved_site)
 [280-325]  PS00041
PS00041   HTH_ARAC_FAMILY_1
IPR020449 Transcription regulator HTH, AraC- type (Family)
 [298-313]  2.59999946718995e-06 PR00032 [313-329]  2.59999946718995e-06 PR00032
PR00032   HTHARAC
SignalP
 [1-26]  0.784 Signal
Eukaryota   
 [1-32]  0.347 Signal
Bacteria, Gram-positive   
TMHMM No significant hit